Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXD4L1 Rabbit Polyclonal Antibody (HRP)

FOXD4L1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FOXD5, bA395L14.1

UniProt

Q9NU39

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FOXD4L1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEASQKFLEQSLQPG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_036316

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PcCMV-sfGFP-Wtap-FLAG-Zeo Plasmid
PVT74758 2 µg

PcCMV-sfGFP-Wtap-FLAG-Zeo Plasmid

Sign In for Pricing
View Details
VPS16 Antibody - N-terminal region : Biotin (ARP57713_P050-Biotin)
ARP57713_P050-Biotin 100 µL

VPS16 Antibody - N-terminal region : Biotin (ARP57713_P050-Biotin)

Sign In for Pricing
View Details
KIAA1310, ID (KANSL3, KIAA1310, NSL3, PRTD, SI1, KAT8 regulatory NSL complex subunit 3, NSL complex protein NSL3, Non-specific lethal 3 homolog, Serum inhibited-related protein, Testis development protein PRTD) (MaxLight 490) discontinued
037409-ML490 100 µL

KIAA1310, ID (KANSL3, KIAA1310, NSL3, PRTD, SI1, KAT8 regulatory NSL complex subunit 3, NSL complex protein NSL3, Non-specific lethal 3 homolog, Serum inhibited-related protein, Testis development protein PRTD) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Caveolin 2 (Phospho-Y19) polyclonal antibody
BS64547-01 50 µL

Caveolin 2 (Phospho-Y19) polyclonal antibody

Sign In for Pricing
View Details
Caveolin 2 (Phospho-Y19) polyclonal antibody
BS64547-02 100 µL

Caveolin 2 (Phospho-Y19) polyclonal antibody

Sign In for Pricing
View Details
ELF3 (Biotin)
561360-01 50 µL

ELF3 (Biotin)

Sign In for Pricing
View Details