Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBX20 Rabbit Polyclonal Antibody (FITC)

TBX20 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ASD4

UniProt

Q9UMR3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TBX20

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RLGMPLTPSAIASSMQGSGPTFPSFHMPRYHHYFQQGPYAAIQGLRHSSA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BACE1 Monoclonal Antibody, AbBy Fluor™ 750 Conjugated
bsm-63071R-BF750 100 µL

BACE1 Monoclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
C14orf177 sgRNA CRISPR Lentivector (Human) (Target 1)
K0305502 1.0 µg DNA

C14orf177 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Nuphar advena ATP synthase subunit c, chloroplastic (atpH)
orb2936346-01 20 µg

Recombinant Nuphar advena ATP synthase subunit c, chloroplastic (atpH)

Sign In for Pricing
View Details
Recombinant Nuphar advena ATP synthase subunit c, chloroplastic (atpH)
orb2936346-02 100 µg

Recombinant Nuphar advena ATP synthase subunit c, chloroplastic (atpH)

Sign In for Pricing
View Details
Tnnc2 3'UTR Luciferase Stable Cell Line
TU120917 1.0 mL

Tnnc2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral human CDH7 shRNA (UAS) - Lentiviral human CDH7 shRNA (UAS, GFP) (100)
GTR15308784 1 Vial

Lentiviral human CDH7 shRNA (UAS) - Lentiviral human CDH7 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details