Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nuphar advena ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Nuphar advena ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-81.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q4FGF0

Expression Region

1-81

Origin

Nuphar advena (Common spatterdock) (Nuphar lutea subsp. advena)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EZEE-12, 12 Pre-stained Proteins with molecular weights from 11 to 250 kDa 1x500ul vial
EZEE-12 1x 500 µL Vial

EZEE-12, 12 Pre-stained Proteins with molecular weights from 11 to 250 kDa 1x500ul vial

Sign In for Pricing
View Details
Mmu-miR-374b-3p miRNA Antagomir
orb1913395-01 10 nmol

Mmu-miR-374b-3p miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-374b-3p miRNA Antagomir
orb1913395-02 20 nmol

Mmu-miR-374b-3p miRNA Antagomir

Sign In for Pricing
View Details
ACADM Rabbit Monoclonal Antibody
E10G20997 100 µL

ACADM Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Polyclonal OXER1 Antibody (aa212-261)
APR17693G 0.05ml

Polyclonal OXER1 Antibody (aa212-261)

Sign In for Pricing
View Details
TF Polyclonal Antibody
E91448 100 µL

TF Polyclonal Antibody

Sign In for Pricing
View Details