Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASGRF1 Rabbit Polyclonal Antibody (HRP)

RASGRF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GNRP, GRF1, CDC25, GRF55, CDC25L, H-GRF55, PP13187, ras-GRF1

UniProt

Q13972

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RASGRF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EVSMREESDIDQNQSDDGDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_722522

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

pFUSEss-CHIg-ratG2c
pfusess-rtchg2c 20 µg

pFUSEss-CHIg-ratG2c

Sign In for Pricing
View Details
Olfr527 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4167606 1.0 µg DNA

Olfr527 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant KRT7 Antibody / Cytokeratin 7
V4281SAF-100UG 100 µg

Recombinant KRT7 Antibody / Cytokeratin 7

Sign In for Pricing
View Details
Siglec 12, CT (Sialic Acid-binding Ig-like Lectin 12, Siglec 12, Sialic Acid-binding Ig-like Lectin-Like 1, Siglec L1, Siglec 12, Siglec L1, SLG, UNQ9215/PRO34042) (MaxLight 550)
MBS6499497-01 0.1 mL

Siglec 12, CT (Sialic Acid-binding Ig-like Lectin 12, Siglec 12, Sialic Acid-binding Ig-like Lectin-Like 1, Siglec L1, Siglec 12, Siglec L1, SLG, UNQ9215/PRO34042) (MaxLight 550)

Sign In for Pricing
View Details
Siglec 12, CT (Sialic Acid-binding Ig-like Lectin 12, Siglec 12, Sialic Acid-binding Ig-like Lectin-Like 1, Siglec L1, Siglec 12, Siglec L1, SLG, UNQ9215/PRO34042) (MaxLight 550)
MBS6499497-02 5x 0.1 mL

Siglec 12, CT (Sialic Acid-binding Ig-like Lectin 12, Siglec 12, Sialic Acid-binding Ig-like Lectin-Like 1, Siglec L1, Siglec 12, Siglec L1, SLG, UNQ9215/PRO34042) (MaxLight 550)

Sign In for Pricing
View Details
MDM4 antibody
70R-34534 0.1 mg

MDM4 antibody

Sign In for Pricing
View Details