Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCD3 Rabbit Polyclonal Antibody (HRP)

SMARCD3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Rsc6p, BAF60C, CRACD3

UniProt

Q6STE5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SMARCD3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QSRSAIVQALWQYVKTNRLQDSHDKEYINGDKYFQQIFDCPRLKFSEIPQ

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003069

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAL4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2500207 1.0 µg DNA

TRNAL4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rat Monoclonal LIGHT/TNFSF14 Antibody (885310) [DyLight 488]
FAB17942K 0.1 mL

Rat Monoclonal LIGHT/TNFSF14 Antibody (885310) [DyLight 488]

Sign In for Pricing
View Details
Epimedokoreanin C
MBS5791160 Inquire

Epimedokoreanin C

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis UPF0344 protein SERP0557 (SERP0557)
orb2921398-01 20 µg

Recombinant Staphylococcus epidermidis UPF0344 protein SERP0557 (SERP0557)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis UPF0344 protein SERP0557 (SERP0557)
orb2921398-02 100 µg

Recombinant Staphylococcus epidermidis UPF0344 protein SERP0557 (SERP0557)

Sign In for Pricing
View Details
Human PHOX2B Monoclonal Antibody
orb3152598-01 50 µg

Human PHOX2B Monoclonal Antibody

Sign In for Pricing
View Details