Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis UPF0344 protein SERP0557 (SERP0557)

This Recombinant Staphylococcus epidermidis UPF0344 protein SERP0557 (SERP0557) spans the amino acid sequence from region 1-133.

Product Specifications

Product Name Alternative

UPF0344 protein SERP0557

UniProt

Q5HQJ2

Expression Region

1-133

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHVHILSWVLAIILFIATYLNYSKTQGASPYYKPLHMALRLFMLLTLISGFWELIEEFM AASNGEGGNHMLLTLKMLCGLAVIAFMEISIAKRKKQQTSHKFFWITIILIIITMAIGVI LPWGPISKIFGIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Exosome Rapid Extraction Kit (Milk/Saliva, 2ml/T)
EX3093-01 20 Tests

Exosome Rapid Extraction Kit (Milk/Saliva, 2ml/T)

Sign In for Pricing
View Details
Exosome Rapid Extraction Kit (Milk/Saliva, 2ml/T)
EX3093-02 50 Tests

Exosome Rapid Extraction Kit (Milk/Saliva, 2ml/T)

Sign In for Pricing
View Details
KCNK9 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
25405124 3x 1.0µg DNA

KCNK9 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS621865 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
6- (4-Phenylpiperazin-1-yl) pyridine-3-carbonitrile
RQB49310-01 100 mg

6- (4-Phenylpiperazin-1-yl) pyridine-3-carbonitrile

Sign In for Pricing
View Details
6- (4-Phenylpiperazin-1-yl) pyridine-3-carbonitrile
RQB49310-02 1 g

6- (4-Phenylpiperazin-1-yl) pyridine-3-carbonitrile

Sign In for Pricing
View Details