Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHAF1A Rabbit Polyclonal Antibody (HRP)

CHAF1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CAF1, P150, CAF-1, CAF1B, CAF1P150

UniProt

Q13111

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CAF1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EPGESLSHSEGDDDDDMGEDEDEDDGFFVPHGYLSEDEGVTEECADPENH

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

96kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO2 Antibody
55-088 400 µL

FBXO2 Antibody

Sign In for Pricing
View Details
Hoxb7, ID (Hoxb7, Hoxb-7, R1b, Homeobox protein Hox-B7, Homeobox protein R1B) (MaxLight 550) discontinued
036706-ML550 100 µL

Hoxb7, ID (Hoxb7, Hoxb-7, R1b, Homeobox protein Hox-B7, Homeobox protein R1B) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Glucagon Receptor Rabbit Polyclonal Antibody
orb213972-01 30 µL

Glucagon Receptor Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Glucagon Receptor Rabbit Polyclonal Antibody
orb213972-02 50 μL

Glucagon Receptor Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Glucagon Receptor Rabbit Polyclonal Antibody
orb213972-03 100 µL

Glucagon Receptor Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Glucagon Receptor Rabbit Polyclonal Antibody
orb213972-04 200 µL

Glucagon Receptor Rabbit Polyclonal Antibody

Sign In for Pricing
View Details