Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THAP7 Rabbit Polyclonal Antibody (HRP)

THAP7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

THAP7

UniProt

Q9BT49

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human THAP7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PTIFESFSKLRRTTKTKGHSYPPGPAEVSRLRRCRKRCSEGRGPTTPFSP

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_085050

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Influenza B virus Glycoprotein NB (NB)
orb2934996-01 20 µg

Recombinant Influenza B virus Glycoprotein NB (NB)

Sign In for Pricing
View Details
Recombinant Influenza B virus Glycoprotein NB (NB)
orb2934996-02 100 µg

Recombinant Influenza B virus Glycoprotein NB (NB)

Sign In for Pricing
View Details
APEX2 (AP Endonuclease XTH2, APEX Nuclease-like 2, APEX Nuclease 2, Apurinic-apyrimidinic Endonuclease 2, AP Endonuclease 2, DNA-(apurinic or apyrimidinic site) Lyase 2, APE2, APEXL2, XTH2) (APC)
MBS6463413-01 0.2 mL

APEX2 (AP Endonuclease XTH2, APEX Nuclease-like 2, APEX Nuclease 2, Apurinic-apyrimidinic Endonuclease 2, AP Endonuclease 2, DNA-(apurinic or apyrimidinic site) Lyase 2, APE2, APEXL2, XTH2) (APC)

Sign In for Pricing
View Details
APEX2 (AP Endonuclease XTH2, APEX Nuclease-like 2, APEX Nuclease 2, Apurinic-apyrimidinic Endonuclease 2, AP Endonuclease 2, DNA-(apurinic or apyrimidinic site) Lyase 2, APE2, APEXL2, XTH2) (APC)
MBS6463413-02 5x 0.2 mL

APEX2 (AP Endonuclease XTH2, APEX Nuclease-like 2, APEX Nuclease 2, Apurinic-apyrimidinic Endonuclease 2, AP Endonuclease 2, DNA-(apurinic or apyrimidinic site) Lyase 2, APE2, APEXL2, XTH2) (APC)

Sign In for Pricing
View Details
Rat Bgn ELISA Kit
orb1292623-01 48 Tests

Rat Bgn ELISA Kit

Sign In for Pricing
View Details
Rat Bgn ELISA Kit
orb1292623-02 96 Tests

Rat Bgn ELISA Kit

Sign In for Pricing
View Details