Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza B virus Glycoprotein NB (NB)

This Recombinant Influenza B virus Glycoprotein NB (NB) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Glycoprotein NB

UniProt

P06817

Expression Region

1-100

Origin

Influenza B virus (strain B/Lee/1940)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNATFNCTNINPITHIRGSIIITICVSLIVILIVFGCIAKIFINKNNCTNNVIRVHKRI KCPDCEPFCNKRDDISTPRAGVDIPSFILPGLNLSEGTPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF568 conjugate, 0.1mg/mL
BNC680176-500 1x 500 µL

CD5 (Cris-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
BNC040017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF405S conjugate, 0.1mg/mL
BNC041960-100 1x 100 µL

GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5 + 123A8), CF740 conjugate, 0.1mg/mL
BNC740693-500 1x 500 µL

CD56 / NCAM (123C3.D5 + 123A8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a / HTA1 (Mature Langerhans Cells Marker) (rC1A/711), CF740 conjugate, 0.1mg/mL
BNC741888-100 1x 100 µL

CD1a / HTA1 (Mature Langerhans Cells Marker) (rC1A/711), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details