Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASP3 Rabbit Polyclonal Antibody (HRP)

CASP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CPP32, SCA-1, CPP32B

UniProt

P42574

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CASP3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIII

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_004337

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Dclk1 / Serine/threonine-protein kinase DCLK1 Recombinant Protein
R11793m 1 Each

Mouse Dclk1 / Serine/threonine-protein kinase DCLK1 Recombinant Protein

Sign In for Pricing
View Details
Human Interleukin 19 (IL-19) ELISA Kit
SL1906Hu-01 48 Tests

Human Interleukin 19 (IL-19) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 19 (IL-19) ELISA Kit
SL1906Hu-02 96 Tests

Human Interleukin 19 (IL-19) ELISA Kit

Sign In for Pricing
View Details
Sh2b3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6852905 3x 1.0 µg

Sh2b3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
pCR-BluntII-TOPO-SCUBE2 Plasmid
PVT33388 2 µg

pCR-BluntII-TOPO-SCUBE2 Plasmid

Sign In for Pricing
View Details
FHL1 Antibody
orb1247512 0.1 mg

FHL1 Antibody

Sign In for Pricing
View Details