Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YWHAQ Rabbit Polyclonal Antibody (HRP)

YWHAQ Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

1C5, HS1, 14-3-3

UniProt

P27348

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human YWHAQ

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSIC

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_006817

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aldh1b1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4730202 1.0 µg DNA

Aldh1b1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Fukutin Recombinant Antibody, Biotin Conjugated
bsm-62493R-Biotin 100 µL

Fukutin Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Antiproliferative agent-59
orb2695365-01 10 mg

Antiproliferative agent-59

Sign In for Pricing
View Details
Antiproliferative agent-59
orb2695365-02 50 mg

Antiproliferative agent-59

Sign In for Pricing
View Details
Fbxo6 Mouse shRNA Plasmid (Locus ID 50762)
TR502828 1 Kit

Fbxo6 Mouse shRNA Plasmid (Locus ID 50762)

Sign In for Pricing
View Details
HiEncap™ Luria Agar Base, Miller's Modif
EC1726CCL-25NO 1 unit

HiEncap™ Luria Agar Base, Miller's Modif

Sign In for Pricing
View Details