Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DOK1 Rabbit Polyclonal Antibody (HRP)

DOK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Pp62, P62DOK

UniProt

Q99704

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DOK1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EPGTATGSGIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGST

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_001372

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-PKR (Thr258) Cell-Based ELISA Kit
CBP1768 1 Kit

Phospho-PKR (Thr258) Cell-Based ELISA Kit

Sign In for Pricing
View Details
Thyroxine (T4) (MaxLight 750) discontinued
T5460-ML750 100 µL

Thyroxine (T4) (MaxLight 750) discontinued

Sign In for Pricing
View Details
LOC286987 (NM_173321) Rat Tagged Lenti ORF Clone
RR206726L3 10 µg

LOC286987 (NM_173321) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant (E.Coli) Mouse MIG (CXCL9)
RP-1039 5 µg

Recombinant (E.Coli) Mouse MIG (CXCL9)

Sign In for Pricing
View Details
NAT15 Peptide - middle region
orb2010690 100 µg

NAT15 Peptide - middle region

Sign In for Pricing
View Details
Recombinant Human BTN2A1 (C-6His)
CP88-01 10 µg

Recombinant Human BTN2A1 (C-6His)

Sign In for Pricing
View Details