Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAT15 Peptide - middle region

NAT15 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ11693, NAT15

UniProt

Q9H7X0

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NAT15 Rabbit Polyclonal Antibody (orb325403) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001077070

Preservative

Lyophilized powder

AA Sequence

DYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKSGIEYSRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Junctional sarcoplasmic reticulum protein 1, JSRP1 ELISA Kit
MBS9316388-01 48 Well

Bovine Junctional sarcoplasmic reticulum protein 1, JSRP1 ELISA Kit

Sign In for Pricing
View Details
Bovine Junctional sarcoplasmic reticulum protein 1, JSRP1 ELISA Kit
MBS9316388-02 96 Well

Bovine Junctional sarcoplasmic reticulum protein 1, JSRP1 ELISA Kit

Sign In for Pricing
View Details
Bovine Junctional sarcoplasmic reticulum protein 1, JSRP1 ELISA Kit
MBS9316388-03 5x 96 Well

Bovine Junctional sarcoplasmic reticulum protein 1, JSRP1 ELISA Kit

Sign In for Pricing
View Details
Bovine Junctional sarcoplasmic reticulum protein 1, JSRP1 ELISA Kit
MBS9316388-04 10x 96 Well

Bovine Junctional sarcoplasmic reticulum protein 1, JSRP1 ELISA Kit

Sign In for Pricing
View Details
Oxycodone (N-methyl) D3
CS-O-15077 1 Each

Oxycodone (N-methyl) D3

Sign In for Pricing
View Details
SAS-PEG-SAS, 2K
HO030030-2K-01 1 g

SAS-PEG-SAS, 2K

Sign In for Pricing
View Details