Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHM Rabbit Polyclonal Antibody (FITC)

CHM Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TCD, GGTA, REP-1, DXS540, HSD-32

UniProt

P24386

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CHM

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LHVDSRSYYGGNWASFSFSGLLSWLKEYQENSDIVSDSPVWQDQILENEE

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_000381

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish FZD8A Rabbit Polyclonal Antibody (PE)
orb3130680 100 µg

Zebrafish FZD8A Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Asb11 Rabbit Polyclonal Antibody (HRP)
orb2110283 100 µL

Asb11 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
ALLC (Allantoate Amidinohydrolase, Probable Allantoicase)
MBS646566-01 0.1 mg

ALLC (Allantoate Amidinohydrolase, Probable Allantoicase)

Sign In for Pricing
View Details
ALLC (Allantoate Amidinohydrolase, Probable Allantoicase)
MBS646566-02 5x 0.1 mg

ALLC (Allantoate Amidinohydrolase, Probable Allantoicase)

Sign In for Pricing
View Details
SURF6 Protein Vector (Mouse) (pPM-C-His)
PV235365 500 ng

SURF6 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
B7H4 (B7-H4, B7S1, B7x, BC032925, Immune Costimulatory Protein B7H4, MGC41287, PRO1291, T Cell Costimulatory Molecule B7x, V Set Domain-containing T Cell Activation Inhibitor 1, VCTN1) (AP) discontinued
B0000-35B-AP 100 µL

B7H4 (B7-H4, B7S1, B7x, BC032925, Immune Costimulatory Protein B7H4, MGC41287, PRO1291, T Cell Costimulatory Molecule B7x, V Set Domain-containing T Cell Activation Inhibitor 1, VCTN1) (AP) discontinued

Sign In for Pricing
View Details