Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Asb11 Rabbit Polyclonal Antibody (HRP)

Asb11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1566298

UniProt

D3ZSF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGDYICHTFQGDCWADRSPLHEAAAQGRLLALKTLIAQGINVNLVTINRV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001100432

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Skin
CR561783 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/2480), CF568 conjugate, 0.1mg/mL
BNC682480-500 1x 500 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/2480), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tceal6 (NM_025355) Mouse Tagged ORF Clone
MG202020 10 µg

Tceal6 (NM_025355) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PD-L1 (Cd274) Mouse Gene Knockout Kit (CRISPR)
KN502893 1 Kit

PD-L1 (Cd274) Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse FGFR4/CD334 Protein (His Tag)
PKSM040810 100 µg

Recombinant Mouse FGFR4/CD334 Protein (His Tag)

Sign In for Pricing
View Details
RBMS1 Polyclonal Antibody
E-AB-15836-01 20 µL

RBMS1 Polyclonal Antibody

Sign In for Pricing
View Details