Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NANOG Rabbit Polyclonal Antibody (FITC)

NANOG Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q6NSW7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NANOG

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPK

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_079141

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C11orf57 Rabbit Polyclonal Antibody (BF647)
orb2371672 100 µL

C11orf57 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
TNP1 Rabbit Polyclonal Antibody (Biotin)
orb2107483 100 µL

TNP1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:1b Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (arnT), partial
MBS1158329-01 1 mg (E-Coli)

Recombinant Yersinia pseudotuberculosis serotype O:1b Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (arnT), partial

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:1b Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (arnT), partial
MBS1158329-02 1 mg (Yeast)

Recombinant Yersinia pseudotuberculosis serotype O:1b Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (arnT), partial

Sign In for Pricing
View Details
Myf5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6026706 1.0 µg DNA

Myf5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
CSN3 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV791366 1.0 µg DNA

CSN3 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details