Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNP1 Rabbit Polyclonal Antibody (Biotin)

TNP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TP1

UniProt

P09430

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TNP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRN

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

6kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_003275

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCEAL1 (Transcription Elongation Factor A (SII) -like 1, SIIR, p21, pp21) (HRP)
252459-HRP 100 µL

TCEAL1 (Transcription Elongation Factor A (SII) -like 1, SIIR, p21, pp21) (HRP)

Sign In for Pricing
View Details
Tpcn1 siRNA Oligos set (Rat)
47349176 3x 5 nmol

Tpcn1 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Placental lactogen Antibody, mAb, Rabbit
A04897-100 100 µL

Placental lactogen Antibody, mAb, Rabbit

Sign In for Pricing
View Details
PPP1R9A (Neurabin-1, Neurabin-I, Neural Tissue-specific F-actin-binding Protein I, Protein Phosphatase 1 Regulatory Subunit 9A, KIAA1222, FLJ20068) (FITC)
131708-FITC 100 µL

PPP1R9A (Neurabin-1, Neurabin-I, Neural Tissue-specific F-actin-binding Protein I, Protein Phosphatase 1 Regulatory Subunit 9A, KIAA1222, FLJ20068) (FITC)

Sign In for Pricing
View Details
ANKDD1B, CT (ANKDD1B, Ankyrin repeat and death domain-containing protein 1B) (AP) discontinued
031878-AP 200 µL

ANKDD1B, CT (ANKDD1B, Ankyrin repeat and death domain-containing protein 1B) (AP) discontinued

Sign In for Pricing
View Details
SIGLEC7 (Sialic Acid-binding Ig-like Lectin 7, Siglec-7, Adhesion Inhibitory Receptor Molecule 1, AIRM1, AIRM-1, CD328, CDw328, D-siglec, p75, QA79 Membrane Protein, SIGLECP2, SIGLEC19P) (FITC)
133346-FITC 100 µL

SIGLEC7 (Sialic Acid-binding Ig-like Lectin 7, Siglec-7, Adhesion Inhibitory Receptor Molecule 1, AIRM1, AIRM-1, CD328, CDw328, D-siglec, p75, QA79 Membrane Protein, SIGLECP2, SIGLEC19P) (FITC)

Sign In for Pricing
View Details