Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF2H2 Rabbit Polyclonal Antibody (FITC)

GTF2H2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P44, BTF2, TFIIH, BTF2P44, T-BTF2P44

UniProt

Q13888

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GTF2H2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCD

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001506

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hr Mouse Pre-designed siRNA Set A
HY-RS16724 1 Set

Hr Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
MIOX Mouse Monoclonal Antibody [Clone ID: OTI5F8]
TA501424 100 µL

MIOX Mouse Monoclonal Antibody [Clone ID: OTI5F8]

Sign In for Pricing
View Details
KIDINS220, CT (KIDINS220, ARMS, KIAA1250, Kinase D-interacting substrate of 220kD, Ankyrin repeat-rich membrane-spanning protein) (FITC) discontinued
037431-FITC 200 µL

KIDINS220, CT (KIDINS220, ARMS, KIAA1250, Kinase D-interacting substrate of 220kD, Ankyrin repeat-rich membrane-spanning protein) (FITC) discontinued

Sign In for Pricing
View Details
PF4 CytoSection
TS411322P5 25 Slides

PF4 CytoSection

Sign In for Pricing
View Details
Recombinant Macaca mulatta Interferon gamma (IFNG), Biotinylated
orb2992215-01 20 µg

Recombinant Macaca mulatta Interferon gamma (IFNG), Biotinylated

Sign In for Pricing
View Details
Recombinant Macaca mulatta Interferon gamma (IFNG), Biotinylated
orb2992215-02 100 µg

Recombinant Macaca mulatta Interferon gamma (IFNG), Biotinylated

Sign In for Pricing
View Details