Recombinant Macaca mulatta Interferon gamma (IFNG), Biotinylated
This Recombinant Macaca mulatta Interferon gamma (IFNG), Biotinylated spans the amino acid sequence from region 24-165aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
IFN-gamma; IFNG
UniProt
P63310
Expression Region
24-165aa
Tag
C-terminal 10xHis-Avi-tagged
Source
Mammalian cell
Origin
Macaca mulatta (Rhesus macaque)
Field of Research
Infectious Disease & Virology; Immunology & Inflammation
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
20.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
044335-ML650 100 µL
ZNF695, ID (ZNF695, Zinc finger protein 695, Zinc finger protein SBZF3) (MaxLight 650) discontinued
Sign In for Pricing
View Details bs-9978R-PerCP-Cy5.5 100 µL
C21orf58 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
Sign In for Pricing
View Details MBS2903242 Inquire
Human LAMC1 / Laminin Subunit Gamma-1 Recombinant Protein
Sign In for Pricing
View Details