Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAL1 Rabbit Polyclonal Antibody (Biotin)

TAL1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SCL, TCL5, tal-1, bHLHa17

UniProt

P17542

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TAL1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: INFLAKLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVL

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003180

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNB1 (phospho-S805) polyclonal antibody
BS64353-01 50 µL

KCNB1 (phospho-S805) polyclonal antibody

Sign In for Pricing
View Details
KCNB1 (phospho-S805) polyclonal antibody
BS64353-02 100 µL

KCNB1 (phospho-S805) polyclonal antibody

Sign In for Pricing
View Details
GCAT Double Nickase Plasmid (h)
sc-411745-NIC 20 µg

GCAT Double Nickase Plasmid (h)

Sign In for Pricing
View Details
SPN Protein Vector (Mouse) (pPB-C-His)
PV233470 500 ng

SPN Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Akr1b7 AAV siRNA Pooled Vector
11683166 1.0 µg

Akr1b7 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Rgnef sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6263707 1.0 µg DNA

Rgnef sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details