Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INTS10 Rabbit Polyclonal Antibody (FITC)

INTS10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

INT10, C8orf35

UniProt

Q9NVR2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human INTS10

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MVLPIQDGGKSQEEPSKVKPKFRKGSDLKLLPCTSKAIMPYCLHLMLACF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

82kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060612

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIRacle™ mmu-miR-8099 miRNA Agomir/Antagomir
AM4389 2 OD, 4 OD, 50 OD

MIRacle™ mmu-miR-8099 miRNA Agomir/Antagomir

Sign In for Pricing
View Details
Lentiviral human C19orf71 shRNA (UAS) - Lentiviral human C19orf71 shRNA (UAS, RFP) (25)
GTR15100247 1 Vial

Lentiviral human C19orf71 shRNA (UAS) - Lentiviral human C19orf71 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
MIRacle™ hsa-miR-365b-5p miRNA Agomir/Antagomir
AM2527 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-365b-5p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
ECH1 Rabbit Polyclonal Antibody (BF680)
orb2528402 100 µL

ECH1 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
AGP-2 (Alpha-1-acid Glycoprotein 2, AGP 2, Orosomucoid-2, Orosomucoid 2, Orosomucoid2, OMD 2, OMD2, ORM2, ORM-2, AGP2) discontinued
220623-01 50 µL

AGP-2 (Alpha-1-acid Glycoprotein 2, AGP 2, Orosomucoid-2, Orosomucoid 2, Orosomucoid2, OMD 2, OMD2, ORM2, ORM-2, AGP2) discontinued

Sign In for Pricing
View Details
AGP-2 (Alpha-1-acid Glycoprotein 2, AGP 2, Orosomucoid-2, Orosomucoid 2, Orosomucoid2, OMD 2, OMD2, ORM2, ORM-2, AGP2) discontinued
220623-02 100 µL

AGP-2 (Alpha-1-acid Glycoprotein 2, AGP 2, Orosomucoid-2, Orosomucoid 2, Orosomucoid2, OMD 2, OMD2, ORM2, ORM-2, AGP2) discontinued

Sign In for Pricing
View Details