Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPTC7 Rabbit Polyclonal Antibody (HRP)

PPTC7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TAPP2C, TA-PP2C

UniProt

Q8NI37

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PPTC7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PDYMILQELKKLKNSNYESIQQTARSIAEQAHELAYDPNYMSPFAQFACD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_644812

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Transthyretin Protein
orb1477842-01 20 µg

Mouse Transthyretin Protein

Sign In for Pricing
View Details
Mouse Transthyretin Protein
orb1477842-02 100 µg

Mouse Transthyretin Protein

Sign In for Pricing
View Details
Mouse Transthyretin Protein
orb1477842-03 1 mg

Mouse Transthyretin Protein

Sign In for Pricing
View Details
PBEF (Pre-B cell Colony Enhancing Factor, Pre-B cell Enhancing Factor, MGC117256, Nicotinamide Phosphoribosyltransferase, NAmPRTase, NAMPT, Pre-B cell Colony Enhancing Factor 1, PBEF1, Visfatin, VF) (Carboxyfluorescein)
P3113-97L4 100 µL

PBEF (Pre-B cell Colony Enhancing Factor, Pre-B cell Enhancing Factor, MGC117256, Nicotinamide Phosphoribosyltransferase, NAmPRTase, NAMPT, Pre-B cell Colony Enhancing Factor 1, PBEF1, Visfatin, VF) (Carboxyfluorescein)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Ubiquitin Specific Peptidase 8 (USP8)
MBS2075993-01 0.1 mL

APC-Linked Polyclonal Antibody to Ubiquitin Specific Peptidase 8 (USP8)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Ubiquitin Specific Peptidase 8 (USP8)
MBS2075993-02 0.2 mL

APC-Linked Polyclonal Antibody to Ubiquitin Specific Peptidase 8 (USP8)

Sign In for Pricing
View Details