Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Transthyretin Protein

This Mouse Transthyretin Protein spans the amino acid sequence from region 21-147aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Prealbumin)

UniProt

P07309

Expression Region

21-147aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr at 5 μg/mL can bind Mouse Rbp4, the EC50 is 17.06-26.23 ng/mL.

Form

Lyophilized powder

Molecular Weight

16.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCC112 (PDS5A) (C-term) Rabbit Polyclonal Antibody
AP53248PU-N 400 µL

SCC112 (PDS5A) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human GET1-SH3BGR activation kit by CRISPRa
GA119780 1 Kit

Human GET1-SH3BGR activation kit by CRISPRa

Sign In for Pricing
View Details
PECI (ECI2) (NM_001166010) Human Recombinant Protein
TP328846M 100 µg

PECI (ECI2) (NM_001166010) Human Recombinant Protein

Sign In for Pricing
View Details
Human Aph 1b (APH1B) activation kit by CRISPRa
GA113180 1 Kit

Human Aph 1b (APH1B) activation kit by CRISPRa

Sign In for Pricing
View Details
Porcine Alpha-2-Heremans Schmid Glycoprotein (aHSG) ELISA Kit
RDR-aHSG-p-01 96 Tests

Porcine Alpha-2-Heremans Schmid Glycoprotein (aHSG) ELISA Kit

Sign In for Pricing
View Details
Porcine Alpha-2-Heremans Schmid Glycoprotein (aHSG) ELISA Kit
RDR-aHSG-p-02 48 Tests

Porcine Alpha-2-Heremans Schmid Glycoprotein (aHSG) ELISA Kit

Sign In for Pricing
View Details