Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYNGAP1, Human (His)

SYNGAP1 protein is a major postsynaptic density component that plays a critical regulatory role in the Ras-cAMP pathway, affecting synaptic function and plasticity. At excitatory synapses, it is part of the NMDAR signaling complex and may influence NMDAR-dependent control of AMPAR potentiation, trafficking, and synaptic plasticity. SYNGAP1 Protein, Human (His) is the recombinant human-derived SYNGAP1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

SYNGAP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/syngap1-protein-human-his.html

Purity

94.00

Smiles

MPHLSADIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH

Molecular Formula

8831 (Gene_ID) Q96PV0 (M1161-H1343) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCOR3 (NM_001136225) Human Over-expression Lysate
LY427862 100 µg

RCOR3 (NM_001136225) Human Over-expression Lysate

Sign In for Pricing
View Details
Apolipoprotein L 4 (APOL4) (Center) Rabbit Polyclonal Antibody
AP17119PU-N 400 µL

Apolipoprotein L 4 (APOL4) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Axitinib
SIH-494-10MG 10 mg

Axitinib

Sign In for Pricing
View Details
Peripherin (PRPH) Mouse Monoclonal Antibody [Clone ID: OTI7E4]
CF806226 100 µg

Peripherin (PRPH) Mouse Monoclonal Antibody [Clone ID: OTI7E4]

Sign In for Pricing
View Details
LRRC32 (NM_005512) Human Over-expression Lysate
LY401690 100 µg

LRRC32 (NM_005512) Human Over-expression Lysate

Sign In for Pricing
View Details
HINT2 (NM_032593) Human Recombinant Protein
TP308371 20 µg

HINT2 (NM_032593) Human Recombinant Protein

Sign In for Pricing
View Details