Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A8-S100A9 Heterodimer, Human (His, solution)

S100A8 consists of calcium and zinc bound S100A8, which plays a critical regulatory role in inflammation and immune responses. As calprotectin, it contributes to leukocyte function, regulates the cytoskeleton, and activates intracellular NADPH oxidase. S100A8-S100A9 Heterodimer Protein, Human (His, solution) is a recombinant protein dimer complex containing human-derived S100A8-S100A9 Heterodimer protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

S100A8-S100A9 Heterodimer Protein, Human (His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a8-a9-heterodimer-protein-human-his.html

Purity

98.0

Smiles

A1:MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEA2:TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Molecular Formula

6279&6280 (Gene_ID) P05109 (M1-E93) (S100A8) &P06702 (T2-P114) (S100A9) (Accession)

Molecular Weight

Approximately 13 kDa & 15-17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMGDH Antibody
8C15359-AAT 50 µg

DMGDH Antibody

Sign In for Pricing
View Details
Fmoc-Leu Wang Resin
H0751501316.25G 25 g

Fmoc-Leu Wang Resin

Sign In for Pricing
View Details
Recombinant Keratin 4 Monoclonal Antibody
AN301579L-01 50 µL

Recombinant Keratin 4 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Keratin 4 Monoclonal Antibody
AN301579L-02 100 µL

Recombinant Keratin 4 Monoclonal Antibody

Sign In for Pricing
View Details
ISX9
SIH-628-5MG 5 mg

ISX9

Sign In for Pricing
View Details
Peroxiredoxin 6 (PRDX6) Mouse Monoclonal Antibody [Clone ID: OTI4D1]
CF813653 100 µg

Peroxiredoxin 6 (PRDX6) Mouse Monoclonal Antibody [Clone ID: OTI4D1]

Sign In for Pricing
View Details