Wnt8b, Mouse (Myc, His-SUMO)
Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.
Product Specifications
Product Name Alternative
Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html
Purity
90.00
Smiles
WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS
Molecular Formula
22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)
Molecular Weight
Approximately 61 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
![BrdU Mouse Monoclonal Antibody [Clone ID: OTI2B5]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
abx361554 96 Tests
Pig Myosin Light Chain 1, Alkali, Fast Skeletal (MYL1) ELISA Kit
Sign In for Pricing
View Details MBS287739-01 48 Tests
Mouse Cystathionine gamma-lyase (CTH) ELISA Kit
Sign In for Pricing
View Details MBS287739-02 96 Tests
Mouse Cystathionine gamma-lyase (CTH) ELISA Kit
Sign In for Pricing
View Details 
MBS287739-03 5x 96 Tests
Mouse Cystathionine gamma-lyase (CTH) ELISA Kit
Sign In for Pricing
View Details 
MBS287739-04 10x 96 Tests
Mouse Cystathionine gamma-lyase (CTH) ELISA Kit
Sign In for Pricing
View Details