Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8b, Mouse (Myc, His-SUMO)

Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html

Purity

90.00

Smiles

WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS

Molecular Formula

22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)

Molecular Weight

Approximately 61 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat NLRP3 (NACHT, LRR and PYD domains-containing protein 3) ELISA kit
RE3548R-01 48 Tests

Rat NLRP3 (NACHT, LRR and PYD domains-containing protein 3) ELISA kit

Sign In for Pricing
View Details
Rat NLRP3 (NACHT, LRR and PYD domains-containing protein 3) ELISA kit
RE3548R-02 96 Tests

Rat NLRP3 (NACHT, LRR and PYD domains-containing protein 3) ELISA kit

Sign In for Pricing
View Details
GR28B Blocking Peptide
MBS5401356-01 0.25 mg

GR28B Blocking Peptide

Sign In for Pricing
View Details
GR28B Blocking Peptide
MBS5401356-02 5x 0.25 mg

GR28B Blocking Peptide

Sign In for Pricing
View Details
Mouse Tmtc1 qPCR Primer Pair
QM73958S 200 Tests

Mouse Tmtc1 qPCR Primer Pair

Sign In for Pricing
View Details
Rqcd1 Adenovirus (Mouse)
42729054 1.0 mL

Rqcd1 Adenovirus (Mouse)

Sign In for Pricing
View Details