Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8b, Mouse (Myc, His-SUMO)

Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html

Purity

90.00

Smiles

WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS

Molecular Formula

22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)

Molecular Weight

Approximately 61 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKUB1 Protein Vector (Human) (pPM-C-His)
PV062496 500 ng

ANKUB1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Dequalinium chloride
D-190-2-5g 5 g

Dequalinium chloride

Sign In for Pricing
View Details
ATAD3C CytoSection
TS429203P5 25 Slides

ATAD3C CytoSection

Sign In for Pricing
View Details
Proglumide sodium salt 100mg
A13713-100 100 mg

Proglumide sodium salt 100mg

Sign In for Pricing
View Details
Plexin A1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61715R-BF647-01 20 µL

Plexin A1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Plexin A1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-61715R-BF647-02 100 µL

Plexin A1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details