Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8b, Mouse (Myc, His-SUMO)

Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html

Purity

90.00

Smiles

WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS

Molecular Formula

22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)

Molecular Weight

Approximately 61 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mir466g Mouse qPCR Template Standard (MI0005510)
MK300334 200 Reactions

Mir466g Mouse qPCR Template Standard (MI0005510)

Sign In for Pricing
View Details
Human CHRNa3 ELISA Kit
E008281 1 Each

Human CHRNa3 ELISA Kit

Sign In for Pricing
View Details
HMOX1 Protein Vector (Human) (pPB-C-His)
PV020021 500 ng

HMOX1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
GABRA1 Antibody (C-term)
MBS9208845-01 0.08 mL

GABRA1 Antibody (C-term)

Sign In for Pricing
View Details
GABRA1 Antibody (C-term)
MBS9208845-02 5x 0.08 mL

GABRA1 Antibody (C-term)

Sign In for Pricing
View Details
TRAIL (TNFSF10) (NM_001190943) Human Tagged ORF Clone Lentiviral Particle
RC230918L4V 200 µL

TRAIL (TNFSF10) (NM_001190943) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details