Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8b, Mouse (Myc, His-SUMO)

Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html

Purity

90.00

Smiles

WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS

Molecular Formula

22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)

Molecular Weight

Approximately 61 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR4F28P Protein Vector (Human) (pPM-C-His)
PV107105 500 ng

OR4F28P Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Bovine Caldesmon (CALD) ELISA Kit
NSL2077Bo 96 Tests

Bovine Caldesmon (CALD) ELISA Kit

Sign In for Pricing
View Details
PIGO Peptide
DF14313-BP 1 mg

PIGO Peptide

Sign In for Pricing
View Details
Rat Anti alpha1 Adrenergic Receptor Antibody ELISA Kit
MBS7254916-01 48 Well

Rat Anti alpha1 Adrenergic Receptor Antibody ELISA Kit

Sign In for Pricing
View Details
Rat Anti alpha1 Adrenergic Receptor Antibody ELISA Kit
MBS7254916-02 96 Well

Rat Anti alpha1 Adrenergic Receptor Antibody ELISA Kit

Sign In for Pricing
View Details
Rat Anti alpha1 Adrenergic Receptor Antibody ELISA Kit
MBS7254916-03 5x 96 Well

Rat Anti alpha1 Adrenergic Receptor Antibody ELISA Kit

Sign In for Pricing
View Details