Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8b, Mouse (Myc, His-SUMO)

Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html

Purity

90.00

Smiles

WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS

Molecular Formula

22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)

Molecular Weight

Approximately 61 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatitis C virus
2841 1 ml

Hepatitis C virus

Sign In for Pricing
View Details
Mouse Lrrc42 Pre-designed siRNA Set A
SI107854A 1 Each

Mouse Lrrc42 Pre-designed siRNA Set A

Sign In for Pricing
View Details
SNORA45 AAV Vector (Human) (CMV)
44614101 1 µg

SNORA45 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Cytochrome P450 2E1 (CYP2E1) Antibody
abx111923 100 µL

Cytochrome P450 2E1 (CYP2E1) Antibody

Sign In for Pricing
View Details
LOC502684 sgRNA CRISPR Lentivector set (Rat)
K6514401 3x 1.0 µg

LOC502684 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
RGD1565972 Protein Vector (Rat) (pPB-N-His)
PV301107 500 ng

RGD1565972 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details