Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8b, Mouse (Myc, His-SUMO)

Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html

Purity

90.00

Smiles

WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS

Molecular Formula

22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)

Molecular Weight

Approximately 61 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VSIG10 (V-Set and Immunoglobulin Domain-Containing Protein 10, V-Set and Immunoglobulin Domain Containing 10)
495469 100 µL

VSIG10 (V-Set and Immunoglobulin Domain-Containing Protein 10, V-Set and Immunoglobulin Domain Containing 10)

Sign In for Pricing
View Details
Pip5k1c (NM_008844) Mouse Tagged ORF Clone
MG221039 10 µg

Pip5k1c (NM_008844) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
LYPLA1
525050-01 100 µL

LYPLA1

Sign In for Pricing
View Details
LYPLA1
525050-02 200 µL

LYPLA1

Sign In for Pricing
View Details
alpha Adducin (ADD1) Rabbit Polyclonal Antibody
TA313191 100 µL

alpha Adducin (ADD1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Kinesis Syringe Gastight 25ml LL
CHR1627 1 Each

Kinesis Syringe Gastight 25ml LL

Sign In for Pricing
View Details