Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8b, Mouse (Myc, His-SUMO)

Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html

Purity

90.00

Smiles

WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS

Molecular Formula

22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)

Molecular Weight

Approximately 61 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1085 CRISPR Activation Plasmid (m2)
sc-434715-ACT-2 20 µg

Olfr1085 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Luteinizing Hormone, alpha (LHa) (APC) discontinued
L7500-10-APC 100 µL

Luteinizing Hormone, alpha (LHa) (APC) discontinued

Sign In for Pricing
View Details
4-Ways Microtube and Centrifuge Tubes Racks, Blue
R023-B 1 UNIT

4-Ways Microtube and Centrifuge Tubes Racks, Blue

Sign In for Pricing
View Details
Quick Step Human Glucagon, GC ELISA Kit
QS0762Hu-01 48 Tests

Quick Step Human Glucagon, GC ELISA Kit

Sign In for Pricing
View Details
Quick Step Human Glucagon, GC ELISA Kit
QS0762Hu-02 96 Tests

Quick Step Human Glucagon, GC ELISA Kit

Sign In for Pricing
View Details
C / EBP alpha (pS21) Antibody
abx011899 100 µg

C / EBP alpha (pS21) Antibody

Sign In for Pricing
View Details