Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8b, Mouse (Myc, His-SUMO)

Wnt8b Protein, a frizzled receptor ligand, is involved in the development and differentiation of specific forebrain structures, notably the hippocampus.Wnt8b Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived Wnt8b protein, expressed by E.coli , with N-His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Wnt8b Protein, Mouse (Myc, His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/protein-wnt-8b-wnt8b-protein-mouse-myc-his-sumo.html

Purity

90.00

Smiles

WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS

Molecular Formula

22423 (Gene_ID) Q9WUD6 (W22-S350) (Accession)

Molecular Weight

Approximately 61 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diphenyl p-Hydroxyphenyl Phosphate-d10 (major)
TRC-D492429-10MG 10 mg

Diphenyl p-Hydroxyphenyl Phosphate-d10 (major)

Sign In for Pricing
View Details
Mouse Keratin, Type I Cytoskeletal 14 (KRT14) ELISA Kit
MBS9388931-01 48 Well

Mouse Keratin, Type I Cytoskeletal 14 (KRT14) ELISA Kit

Sign In for Pricing
View Details
Mouse Keratin, Type I Cytoskeletal 14 (KRT14) ELISA Kit
MBS9388931-02 96 Well

Mouse Keratin, Type I Cytoskeletal 14 (KRT14) ELISA Kit

Sign In for Pricing
View Details
Mouse Keratin, Type I Cytoskeletal 14 (KRT14) ELISA Kit
MBS9388931-03 5x 96 Well

Mouse Keratin, Type I Cytoskeletal 14 (KRT14) ELISA Kit

Sign In for Pricing
View Details
Mouse Keratin, Type I Cytoskeletal 14 (KRT14) ELISA Kit
MBS9388931-04 10x 96 Well

Mouse Keratin, Type I Cytoskeletal 14 (KRT14) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal ACF1 Antibody
NBP1-90270-25ul 25 µL

Rabbit Polyclonal ACF1 Antibody

Sign In for Pricing
View Details