Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAMBI/NMA, Mouse (HEK293, His)

Product Specifications

Product Name Alternative

HEK293

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bambi-nma-protein-mouse-hek293-his.html

Purity

97.00

Smiles

EIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNTNSPLTHGCLDSLASTADICRAKQAQNHSGPAMPTLECCHEDMCNYRGLHDVLSPSKSEASGQGNRYQHDSSRNLITKMQELTSSKELWFRA

Molecular Weight

Approximately 19-24 kDa due to the glycosylation

Shipping Conditions

Blue Ice

Storage Conditions

Stored at -20°C for 2 years

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LSECtin/CLEC4G Alexa Fluor 647 Antibody
FAB2947R-100UG 100 µg

Human LSECtin/CLEC4G Alexa Fluor 647 Antibody

Sign In for Pricing
View Details
NOX3 Rabbit pAb (APR25285N)
APR25285N-01 50 µL

NOX3 Rabbit pAb (APR25285N)

Sign In for Pricing
View Details
NOX3 Rabbit pAb (APR25285N)
APR25285N-02 100 µL

NOX3 Rabbit pAb (APR25285N)

Sign In for Pricing
View Details
NOX3 Rabbit pAb (APR25285N)
APR25285N-03 200 µL

NOX3 Rabbit pAb (APR25285N)

Sign In for Pricing
View Details
Anti-OTC Antibody
CQA3625-01 30 µL

Anti-OTC Antibody

Sign In for Pricing
View Details
Anti-OTC Antibody
CQA3625-02 50 μL

Anti-OTC Antibody

Sign In for Pricing
View Details