NOX3 Rabbit pAb (APR25285N)
Product Specifications
Background
This gene encodes a member of the NOX family of NADPH oxidases. These enzymes have the capacity to generate superoxide and other reactive oxygen species (ROS) and transport electrons across the plasma membrane. The ROS generated by family members have been implicated in numerous biological functions including host defense, posttranlational processing of proteins, cellular signaling, regulation of gene expression, and cell differentiation. The protein encoded by this gene is expressed predominantly in the inner ear and is involved in the biogenesis of otoconia/otolith, which are crystalline structures of the inner ear involved in the perception of gravity.
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NOX3 Rabbit pAb (APR25285N) .
Synonyms
NOX3; GP91-3; MOX-2
Gene ID
50508
UniProt
Q9HBY0
Cellular Locus
Membrane, Multi-pass membrane protein
Applications
IHC (Mus musculus) WB (Mus musculus)
Dilution
WB 1:200 - 1:2000
Form
Liquid
Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Molecular Weight
Calculated MW: 64kDa Observed MW: 65kDa
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Gene ID URL
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=50508
Uniprot URL
https://www.uniprot.org/uniprot/Q9HBY0
AA Sequence
GRIVRGQTQDSLSLHNITFCRDRYAEWQTVAQCPVPQFSGKEPSAWKWILGPVVLYACERIIRFWRFQQEVVITKVVSHPSGVLELHMKKRGFKMAPGQYILVQCPAISSLEWHPFTLTSAPQEDFFSVHIRAAGDWTAALLEAFGAEGQALQEPWSLPRLAVDGPFGTALTD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10336758 96 Well
Rat ATP synthase lipid binding protein, mitochondrial (ATP5G1) ELISA Kit
Sign In for Pricing
View Details 
MBS6461302-01 0.1 mL
Activation-induced Cytidine Deaminase, CT (Activation Induced Cytidine Deaminase, Activation-induced Deaminase, AICDA, AID, ARP2, CDA2, Cytidine Aminohydrolase, HIGM2, Integrated into Burkitt's Lymphoma Cell Line Ramos) (APC)
Sign In for Pricing
View Details MBS6461302-02 5x 0.1 mL
Activation-induced Cytidine Deaminase, CT (Activation Induced Cytidine Deaminase, Activation-induced Deaminase, AICDA, AID, ARP2, CDA2, Cytidine Aminohydrolase, HIGM2, Integrated into Burkitt's Lymphoma Cell Line Ramos) (APC)
Sign In for Pricing
View Details