Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pectobacterium carotovorum subsp. carotovorum Cell division protein FtsB (ftsB), partial

Product Specifications

CAS Number

9000-83-3

Gene Name

[ftsB]

Storage Conditions

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Other Gene Names

[ftsB]

Short Name

[Cell division protein FtsB (ftsB)]

Other Product Names

[cell division protein FtsB; Cell division protein FtsB]

NCBI GI Number

506321725

NCBI Accession Number

WP_015841500.1

NCBI GB Accession Number

WP_015841500.1

Uniprot Accession Number

C6DDG3

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myo1g sgRNA CRISPR Lentivector (Rat) (Target 3)
K7275304 1.0 µg DNA

Myo1g sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
MBS5818107 Inquire

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Sign In for Pricing
View Details
ATP2A1 Polyclonal Antibody
MBS9129123-01 0.02 mL

ATP2A1 Polyclonal Antibody

Sign In for Pricing
View Details
ATP2A1 Polyclonal Antibody
MBS9129123-02 0.1 mL

ATP2A1 Polyclonal Antibody

Sign In for Pricing
View Details
ATP2A1 Polyclonal Antibody
MBS9129123-03 5x 0.1 mL

ATP2A1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-PLC gamma 2 Antibody
YLD6264-01 50 µL

Rabbit anti-PLC gamma 2 Antibody

Sign In for Pricing
View Details