Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Product Specifications

Gene Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

More Discoveries

Explore Other Products

Browse additional items from our catalog

[Nle8’18, Tyr34]-pTH (1-34) amide (bovine)
5-00259 4x 1 mg

[Nle8’18, Tyr34]-pTH (1-34) amide (bovine)

Sign In for Pricing
View Details
Cavy Olfactory Receptor 1E2 (OR1E2) ELISA Kit
MBS9349650 Inquire

Cavy Olfactory Receptor 1E2 (OR1E2) ELISA Kit

Sign In for Pricing
View Details
Monoclonal Anti-Albumin (Capture or Detection Ab)
BDA1026 1 mg

Monoclonal Anti-Albumin (Capture or Detection Ab)

Sign In for Pricing
View Details
FTO Knockout CaSki Polyclonal Cells
ARG9826 1 Million

FTO Knockout CaSki Polyclonal Cells

Sign In for Pricing
View Details
TPOR/MPL Rabbit mAb
MBS4753074-01 0.1 mL

TPOR/MPL Rabbit mAb

Sign In for Pricing
View Details
TPOR/MPL Rabbit mAb
MBS4753074-02 5x 0.1 mL

TPOR/MPL Rabbit mAb

Sign In for Pricing
View Details