Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Product Specifications

Gene Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Antigen CD11A (p180), lymphocyte function associated antigen 1, alpha polypeptide, Integrin alpha-L, ITGAL, Leukocyte Adhesion Glycoprotein LFA1 Alpha Chain, LFA 1 alpha (LFA1A), Ly15, Ly21, Lymphocyte function associated antigen 1, p180) (BSA & Az
MBS6215046-01 0.1 mL

CD11a (Antigen CD11A (p180), lymphocyte function associated antigen 1, alpha polypeptide, Integrin alpha-L, ITGAL, Leukocyte Adhesion Glycoprotein LFA1 Alpha Chain, LFA 1 alpha (LFA1A), Ly15, Ly21, Lymphocyte function associated antigen 1, p180) (BSA & Az

Sign In for Pricing
View Details
CD11a (Antigen CD11A (p180), lymphocyte function associated antigen 1, alpha polypeptide, Integrin alpha-L, ITGAL, Leukocyte Adhesion Glycoprotein LFA1 Alpha Chain, LFA 1 alpha (LFA1A), Ly15, Ly21, Lymphocyte function associated antigen 1, p180) (BSA & Az
MBS6215046-02 5x 0.1 mL

CD11a (Antigen CD11A (p180), lymphocyte function associated antigen 1, alpha polypeptide, Integrin alpha-L, ITGAL, Leukocyte Adhesion Glycoprotein LFA1 Alpha Chain, LFA 1 alpha (LFA1A), Ly15, Ly21, Lymphocyte function associated antigen 1, p180) (BSA & Az

Sign In for Pricing
View Details
Exoc1 3'UTR GFP Stable Cell Line
TU156004 1.0 mL

Exoc1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Histone Deacetylase 6 (HDAC6) Antibody
abx125934-01 60 µL

Histone Deacetylase 6 (HDAC6) Antibody

Sign In for Pricing
View Details
Histone Deacetylase 6 (HDAC6) Antibody
abx125934-02 120 µL

Histone Deacetylase 6 (HDAC6) Antibody

Sign In for Pricing
View Details
Histone Deacetylase 6 (HDAC6) Antibody
abx125934-03 200 µL

Histone Deacetylase 6 (HDAC6) Antibody

Sign In for Pricing
View Details