Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Product Specifications

Gene Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal CD163 Antibody (clone 3B4), Clone: 3B4
AMM02241G 0.05ml

Monoclonal CD163 Antibody (clone 3B4), Clone: 3B4

Sign In for Pricing
View Details
Endothelium (MaxLight 750)
MBS6256960-01 0.1 mL

Endothelium (MaxLight 750)

Sign In for Pricing
View Details
Endothelium (MaxLight 750)
MBS6256960-02 5x 0.1 mL

Endothelium (MaxLight 750)

Sign In for Pricing
View Details
Human Monoclonal EGFR Antibody (Hu1) [Janelia Fluor 549]
FAB9577I 0.1 mL

Human Monoclonal EGFR Antibody (Hu1) [Janelia Fluor 549]

Sign In for Pricing
View Details
Mouse Monoclonal EphB6 Antibody (465327) [DyLight 550]
FAB33841L 0.1 mL

Mouse Monoclonal EphB6 Antibody (465327) [DyLight 550]

Sign In for Pricing
View Details
Nobox 3'UTR GFP Stable Cell Line
TU164186 1.0 mL

Nobox 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details