Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Product Specifications

Gene Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMSC Serum-Free Growth Medium
419SF-500 500 mL

HMSC Serum-Free Growth Medium

Sign In for Pricing
View Details
Chloride Channel CLIC Like Protein 1 (CLCC1) Antibody
abx324300-01 50 µg

Chloride Channel CLIC Like Protein 1 (CLCC1) Antibody

Sign In for Pricing
View Details
Chloride Channel CLIC Like Protein 1 (CLCC1) Antibody
abx324300-02 100 µg

Chloride Channel CLIC Like Protein 1 (CLCC1) Antibody

Sign In for Pricing
View Details
GLRX (Glutaredoxin-1, GRX, GRX1) discontinued
211018-01 20 µL

GLRX (Glutaredoxin-1, GRX, GRX1) discontinued

Sign In for Pricing
View Details
GLRX (Glutaredoxin-1, GRX, GRX1) discontinued
211018-02 100 µL

GLRX (Glutaredoxin-1, GRX, GRX1) discontinued

Sign In for Pricing
View Details
PHYHD1 Antibody
MBS851618-01 0.1 mg

PHYHD1 Antibody

Sign In for Pricing
View Details