Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Product Specifications

Gene Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal HLA DQ Antibody (rSPV-L3) [Alexa Fluor 594]
NBP3-08720AF594 100 µL

Mouse Monoclonal HLA DQ Antibody (rSPV-L3) [Alexa Fluor 594]

Sign In for Pricing
View Details
ZMYM2 Protein Vector (Mouse) (pPB-N-His)
PV250871 500 ng

ZMYM2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
cGAS Rabbit pAb
A21789 200 µL

cGAS Rabbit pAb

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Cytidylate kinase (cmk)
MBS1422669-01 0.02 mg (E-Coli)

Recombinant Xylella fastidiosa Cytidylate kinase (cmk)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Cytidylate kinase (cmk)
MBS1422669-02 0.1 mg (E-Coli)

Recombinant Xylella fastidiosa Cytidylate kinase (cmk)

Sign In for Pricing
View Details
Recombinant Xylella fastidiosa Cytidylate kinase (cmk)
MBS1422669-03 0.02 mg (Yeast)

Recombinant Xylella fastidiosa Cytidylate kinase (cmk)

Sign In for Pricing
View Details