Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Product Specifications

Gene Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

More Discoveries

Explore Other Products

Browse additional items from our catalog

G protein alpha 12 (GNA12) (NM_007353) Human Over-expression Lysate
LC416026 20 µg

G protein alpha 12 (GNA12) (NM_007353) Human Over-expression Lysate

Sign In for Pricing
View Details
ITGAE, CT (ITGAE, Integrin alpha-E, HML-1 antigen, Integrin alpha-IEL, Mucosal lymphocyte 1 antigen, CD103, Integrin alpha-E light chain, Integrin alpha-E heavy chain)
MBS646526-01 0.2 mL

ITGAE, CT (ITGAE, Integrin alpha-E, HML-1 antigen, Integrin alpha-IEL, Mucosal lymphocyte 1 antigen, CD103, Integrin alpha-E light chain, Integrin alpha-E heavy chain)

Sign In for Pricing
View Details
ITGAE, CT (ITGAE, Integrin alpha-E, HML-1 antigen, Integrin alpha-IEL, Mucosal lymphocyte 1 antigen, CD103, Integrin alpha-E light chain, Integrin alpha-E heavy chain)
MBS646526-02 5x 0.2 mL

ITGAE, CT (ITGAE, Integrin alpha-E, HML-1 antigen, Integrin alpha-IEL, Mucosal lymphocyte 1 antigen, CD103, Integrin alpha-E light chain, Integrin alpha-E heavy chain)

Sign In for Pricing
View Details
SEZ6L (NM_001184777) Human Tagged Lenti ORF Clone
RC230590L4 10 µg

SEZ6L (NM_001184777) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Canine F-box only protein 46 (FBXO46) ELISA Kit
MBS7226555-01 48 Well

Canine F-box only protein 46 (FBXO46) ELISA Kit

Sign In for Pricing
View Details
Canine F-box only protein 46 (FBXO46) ELISA Kit
MBS7226555-02 96 Well

Canine F-box only protein 46 (FBXO46) ELISA Kit

Sign In for Pricing
View Details