Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Product Specifications

Gene Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse STAR shRNA Plasmid
abx972905-01 150 µg

Mouse STAR shRNA Plasmid

Sign In for Pricing
View Details
Mouse STAR shRNA Plasmid
abx972905-02 300 µg

Mouse STAR shRNA Plasmid

Sign In for Pricing
View Details
12-Hydroxydihydrochelirubine
MF-0054097-01 10 mg

12-Hydroxydihydrochelirubine

Sign In for Pricing
View Details
12-Hydroxydihydrochelirubine
MF-0054097-02 50 mg

12-Hydroxydihydrochelirubine

Sign In for Pricing
View Details
RAB3IL1 Antibody
A32657-100UL 100 µL

RAB3IL1 Antibody

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to 2', 5'-Oligoadenylate Synthetase Like Protein (OASL)
MBS2077034-01 0.1 mL

Cy3-Linked Polyclonal Antibody to 2', 5'-Oligoadenylate Synthetase Like Protein (OASL)

Sign In for Pricing
View Details