STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
Product Specifications
Gene Name
[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]
Storage Conditions
Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year
Short Name
[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]
More Discoveries
Explore Other Products
Browse additional items from our catalog
K6695704 1.0 µg DNA
Lamb3 sgRNA CRISPR Lentivector (Rat) (Target 3)
Sign In for Pricing
View Details 
MBS2132522-01 0.1 mL
APC_Cy7 Linked Monoclonal Antibody to Clusterin (CLU)
Sign In for Pricing
View Details 
MBS2132522-02 0.2 mL
APC_Cy7 Linked Monoclonal Antibody to Clusterin (CLU)
Sign In for Pricing
View Details 
MBS2132522-03 0.5 mL
APC_Cy7 Linked Monoclonal Antibody to Clusterin (CLU)
Sign In for Pricing
View Details MBS2132522-04 1 mL
APC_Cy7 Linked Monoclonal Antibody to Clusterin (CLU)
Sign In for Pricing
View Details MBS2132522-05 5 mL
APC_Cy7 Linked Monoclonal Antibody to Clusterin (CLU)
Sign In for Pricing
View Details