Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Product Specifications

Gene Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse FCF1 siRNA
abx916682-01 15 nmol

Mouse FCF1 siRNA

Sign In for Pricing
View Details
Mouse FCF1 siRNA
abx916682-02 30 nmol

Mouse FCF1 siRNA

Sign In for Pricing
View Details
PROCR Rat Monoclonal Antibody [Clone ID: RCR-252]
AM26233PU-N 100 µg

PROCR Rat Monoclonal Antibody [Clone ID: RCR-252]

Sign In for Pricing
View Details
Rat Ccrl2 Pre-designed siRNA Set A
SI202263A 1 Each

Rat Ccrl2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
SLC35D3 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
44140064 1.0 µg DNA

SLC35D3 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
rHu IL-2
AK8277-0100 100µg

rHu IL-2

Sign In for Pricing
View Details