Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Product Specifications

Gene Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELA2 (Elastase 2, Neutrophil, GE, HLE, HNE, NE, PMN-E) (PE)
245677-PE 100 µL

ELA2 (Elastase 2, Neutrophil, GE, HLE, HNE, NE, PMN-E) (PE)

Sign In for Pricing
View Details
SNRP70 antibody
70R-1431 100 ug

SNRP70 antibody

Sign In for Pricing
View Details
Pik3cd ORF Vector (Mouse) (pORF)
ORF054055 1.0 µg DNA

Pik3cd ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Plant Double Stranded DNA Antibody (Anti-DSDNA) ELISA Kit
MBS9381326 Inquire

Plant Double Stranded DNA Antibody (Anti-DSDNA) ELISA Kit

Sign In for Pricing
View Details
Anti-Human FBXO45 Polyclonal Antibody
PHC46601 100 μg

Anti-Human FBXO45 Polyclonal Antibody

Sign In for Pricing
View Details
PAN2 Protein Vector (Human) (pPM-C-His)
PV030008 500 ng

PAN2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details