Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Product Specifications

Gene Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dnajc1 Mouse shRNA Plasmid (Locus ID 13418)
TR500544 1 Kit

Dnajc1 Mouse shRNA Plasmid (Locus ID 13418)

Sign In for Pricing
View Details
BC051628 3'UTR Luciferase Stable Cell Line
TU102628 1.0 mL

BC051628 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal UBE2E3 Antibody (OTI7E8) [PE]
NBP2-74745PE 0.1 mL

Mouse Monoclonal UBE2E3 Antibody (OTI7E8) [PE]

Sign In for Pricing
View Details
Polyclonal Antibody to Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)
MBS2025880-01 0.1 mL

Polyclonal Antibody to Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)

Sign In for Pricing
View Details
Polyclonal Antibody to Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)
MBS2025880-02 0.2 mL

Polyclonal Antibody to Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)

Sign In for Pricing
View Details
Polyclonal Antibody to Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)
MBS2025880-03 0.5 mL

Polyclonal Antibody to Ubiquitin Protein Ligase E3 Component N-Recognin 4 (UBR4)

Sign In for Pricing
View Details