Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Product Specifications

Gene Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKD2L1 Rabbit pAb
E47R23401 100 µL

PKD2L1 Rabbit pAb

Sign In for Pricing
View Details
Rabbit Monoclonal FABP8/M-FABP/Myelin P2 Protein Antibody (001) [DyLight 650]
NBP2-89897C 0.1 mL

Rabbit Monoclonal FABP8/M-FABP/Myelin P2 Protein Antibody (001) [DyLight 650]

Sign In for Pricing
View Details
Recombinant Shigella Flexneri argE Protein (aa 1-383)
VAng-Lsx07607-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Flexneri argE Protein (aa 1-383)

Sign In for Pricing
View Details
MTFR1 Polyclonal Antibody
RA33397-01 50 µL

MTFR1 Polyclonal Antibody

Sign In for Pricing
View Details
MTFR1 Polyclonal Antibody
RA33397-02 100 µL

MTFR1 Polyclonal Antibody

Sign In for Pricing
View Details
Htra4 (NM_001107321) Rat Untagged Clone
RN213582 10 µg

Htra4 (NM_001107321) Rat Untagged Clone

Sign In for Pricing
View Details