Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Product Specifications

Gene Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-Off-hsa-miR-6088 Vector
mh32041 500 ng

LentimiRa-Off-hsa-miR-6088 Vector

Sign In for Pricing
View Details
CALR Antibody
MBS9604602-01 0.1 mL

CALR Antibody

Sign In for Pricing
View Details
CALR Antibody
MBS9604602-02 0.2 mL

CALR Antibody

Sign In for Pricing
View Details
CALR Antibody
MBS9604602-03 5x 0.2 mL

CALR Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal OR6K2 Antibody [Janelia Fluor 646]
NBP3-06141JF646 0.1 mL

Rabbit Polyclonal OR6K2 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
EYA1/EYA4 Polyclonal Antibody
JOT-AP15487-01 50ul

EYA1/EYA4 Polyclonal Antibody

Sign In for Pricing
View Details