Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Product Specifications

Gene Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

More Discoveries

Explore Other Products

Browse additional items from our catalog

BACE siRNA (m)
sc-37225 10 µM

BACE siRNA (m)

Sign In for Pricing
View Details
Human Neutral ceramidase, ASAH2 ELISA Kit
MBS9322854-01 48 Well

Human Neutral ceramidase, ASAH2 ELISA Kit

Sign In for Pricing
View Details
Human Neutral ceramidase, ASAH2 ELISA Kit
MBS9322854-02 96 Well

Human Neutral ceramidase, ASAH2 ELISA Kit

Sign In for Pricing
View Details
Human Neutral ceramidase, ASAH2 ELISA Kit
MBS9322854-03 5x 96 Well

Human Neutral ceramidase, ASAH2 ELISA Kit

Sign In for Pricing
View Details
Human Neutral ceramidase, ASAH2 ELISA Kit
MBS9322854-04 10x 96 Well

Human Neutral ceramidase, ASAH2 ELISA Kit

Sign In for Pricing
View Details
Mouse lambda light chain Goat Polyclonal Antibody
SP2185F 1 mg

Mouse lambda light chain Goat Polyclonal Antibody

Sign In for Pricing
View Details