Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Product Specifications

Gene Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

K0317 rabbit pAb
UB-GEN-9792 100 ul

K0317 rabbit pAb

Ask
View Details
Phospho-NuMA (Thr2055) Blocking Peptide
MBS9615258-01 1 mg

Phospho-NuMA (Thr2055) Blocking Peptide

Ask
View Details
Phospho-NuMA (Thr2055) Blocking Peptide
MBS9615258-02 5x 1 mg

Phospho-NuMA (Thr2055) Blocking Peptide

Ask
View Details
Human Hepatocellular Carcinoma Cell [SNU-449 Cells]
AFG-ELL-3570 1x 10^6 Cells

Human Hepatocellular Carcinoma Cell [SNU-449 Cells]

Ask
View Details
Cytochrome C Oxidase subunit VIb (COX6B1) (NM_001863) Human Over-expression Lysate
E45H05900-2 each

Cytochrome C Oxidase subunit VIb (COX6B1) (NM_001863) Human Over-expression Lysate

Ask
View Details
CC2D2A Antibody
MBS9522282-01 0.04 mL

CC2D2A Antibody

Ask
View Details