Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Product Specifications

Gene Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse 4933402N22Rik shRNA (UAS) - Lentiviral mouse 4933402N22Rik shRNA (UAS) (100)
GTR15128310 1 Vial

Lentiviral mouse 4933402N22Rik shRNA (UAS) - Lentiviral mouse 4933402N22Rik shRNA (UAS) (100)

Sign In for Pricing
View Details
Mouse Nckap1l Pre-designed siRNA Set A
SI109136A 1 Each

Mouse Nckap1l Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral human CNTN6 sgRNA gene knockout kit - Lentiviral human CNTN6 sgRNA gene knockout kit (25)
GTR15397773 1 Vial

Lentiviral human CNTN6 sgRNA gene knockout kit - Lentiviral human CNTN6 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Propan-2-ol, GlenDry™, anhydrous
GS9888-500ml 500 mL

Propan-2-ol, GlenDry™, anhydrous

Sign In for Pricing
View Details
Inhibitor mmu-miR-7090-3p AAV miRNA Vector
Amm3172600 500 ng

Inhibitor mmu-miR-7090-3p AAV miRNA Vector

Sign In for Pricing
View Details
Ankyrin repeat and BTB/POZ domain-containing protein 1 (ABTB1) Mouse ELISA Kit
B5063 96 Tests

Ankyrin repeat and BTB/POZ domain-containing protein 1 (ABTB1) Mouse ELISA Kit

Sign In for Pricing
View Details