Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Product Specifications

Gene Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human VEGF R2/KDR Allophycocyanin MAb (Clone 89106)

FAB357A-100 100 Tests

Human VEGF R2/KDR Allophycocyanin MAb (Clone 89106)

Sign In for Pricing

Tmie Mouse shRNA Plasmid (Locus ID 20776)

TR512561 1 Kit

Tmie Mouse shRNA Plasmid (Locus ID 20776)

Sign In for Pricing

RPS19P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

LV783761 1.0 µg DNA

RPS19P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing

2-Hydroxytetrahydrofuran

sc-209203 250 mg

2-Hydroxytetrahydrofuran

Sign In for Pricing

Anti-MYO5B antibody

STJ111294 100 µl

Anti-MYO5B antibody

Sign In for Pricing

ProMatrix Metalloproteinase-7 Recombinant (ProMatrilysin)

PT_41869-01 5 µg

ProMatrix Metalloproteinase-7 Recombinant (ProMatrilysin)

Sign In for Pricing