Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Product Specifications

Gene Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monodon baculovirus PCR kit
PCR-V280-48D 50T

Monodon baculovirus PCR kit

Sign In for Pricing
View Details
PE/TR Anti-Human CD38 Antibody [HIT2]
MBS2569662-01 20 Tests

PE/TR Anti-Human CD38 Antibody [HIT2]

Sign In for Pricing
View Details
PE/TR Anti-Human CD38 Antibody [HIT2]
MBS2569662-02 100 Tests

PE/TR Anti-Human CD38 Antibody [HIT2]

Sign In for Pricing
View Details
PE/TR Anti-Human CD38 Antibody [HIT2]
MBS2569662-03 2x 100 Tests

PE/TR Anti-Human CD38 Antibody [HIT2]

Sign In for Pricing
View Details
PE/TR Anti-Human CD38 Antibody [HIT2]
MBS2569662-04 10x 100 Tests

PE/TR Anti-Human CD38 Antibody [HIT2]

Sign In for Pricing
View Details
Lentiviral mouse Slc30a5 shRNA (UAS) - Lentiviral mouse Slc30a5 shRNA (UAS, GFP) plasmid
GTR15221446 1 Vial

Lentiviral mouse Slc30a5 shRNA (UAS) - Lentiviral mouse Slc30a5 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details