Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Product Specifications

Gene Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Histone H1.4 Antibody
NBP3-16044-20ul 20 µL

Rabbit Polyclonal Histone H1.4 Antibody

Sign In for Pricing
View Details
Stradb-set siRNA/shRNA/RNAi Lentivector (Mouse)
45772094 4x 500 ng

Stradb-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Biotin-Linked Anti-Alpha-1-Acid Glycoprotein (A1AGP)
FY-AB42466-01 1 mL

Biotin-Linked Anti-Alpha-1-Acid Glycoprotein (A1AGP)

Sign In for Pricing
View Details
Biotin-Linked Anti-Alpha-1-Acid Glycoprotein (A1AGP)
FY-AB42466-02 100 µL

Biotin-Linked Anti-Alpha-1-Acid Glycoprotein (A1AGP)

Sign In for Pricing
View Details
Biotin-Linked Anti-Alpha-1-Acid Glycoprotein (A1AGP)
FY-AB42466-03 200 µL

Biotin-Linked Anti-Alpha-1-Acid Glycoprotein (A1AGP)

Sign In for Pricing
View Details
MGLL Polyclonal Antibody
MBS9125404-01 0.02 mL

MGLL Polyclonal Antibody

Sign In for Pricing
View Details