Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Product Specifications

Gene Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Solute Carrier Family 16, Member 1 (SLC16A1) BioAssayTM ELISA Kit (Rat)
153131 96 Tests

Solute Carrier Family 16, Member 1 (SLC16A1) BioAssayTM ELISA Kit (Rat)

Sign In for Pricing
View Details
AKIP1 (BCA3, C11orf17, A-kinase-interacting Protein 1, Breast Cancer-associated Gene 3 Protein, PKA-interacting Protein, Proline-rich Protein BCA3) (FITC)
123148-FITC 100 µL

AKIP1 (BCA3, C11orf17, A-kinase-interacting Protein 1, Breast Cancer-associated Gene 3 Protein, PKA-interacting Protein, Proline-rich Protein BCA3) (FITC)

Sign In for Pricing
View Details
Bordetella pertussis Toxin Antigen
BA120VS4-1 1 mg

Bordetella pertussis Toxin Antigen

Sign In for Pricing
View Details
PFDN4 antibody
FNab06336 100 µg

PFDN4 antibody

Sign In for Pricing
View Details
Dengue Complex, pan
MBS601805-01 1 mg

Dengue Complex, pan

Sign In for Pricing
View Details
Dengue Complex, pan
MBS601805-02 5x 1 mg

Dengue Complex, pan

Sign In for Pricing
View Details