Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Product Specifications

Gene Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICT5040
HY-129094 1 Each

ICT5040

Sign In for Pricing
View Details
PerCP/Cyanine 5.5 Anti-Human CD3 Antibody[HIT3b]
AN00644J-01 20 Tests

PerCP/Cyanine 5.5 Anti-Human CD3 Antibody[HIT3b]

Sign In for Pricing
View Details
PerCP/Cyanine 5.5 Anti-Human CD3 Antibody[HIT3b]
AN00644J-02 100 Tests

PerCP/Cyanine 5.5 Anti-Human CD3 Antibody[HIT3b]

Sign In for Pricing
View Details
PerCP/Cyanine 5.5 Anti-Human CD3 Antibody[HIT3b]
AN00644J-03 2x 100 Tests

PerCP/Cyanine 5.5 Anti-Human CD3 Antibody[HIT3b]

Sign In for Pricing
View Details
EpCAM Antibody
V4918-20UG 20 µg

EpCAM Antibody

Sign In for Pricing
View Details
Raver1 3'UTR Lenti-reporter-Luc Vector
38563086 1.0 µg

Raver1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details