Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Product Specifications

Gene Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

Storage Conditions

Powder: -20 degree C for 3 years | In solvent: -80 degree C for 1 year

Short Name

[STIEEQAKTFLDKFNHEAEDLFYQSSLASWN]

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cfap45 (NM_001024882) Rat Tagged ORF Clone
RR208866 10 µg

Cfap45 (NM_001024882) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal SMC1 [p Ser957] Antibody [Alexa Fluor 488]
NB100-205AF488 0.1 mL

Rabbit Polyclonal SMC1 [p Ser957] Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Recombinant Human Leucine-rich glioma-inactivated protein 1 (LGI1), partial
RPC28443-01 20 µg

Recombinant Human Leucine-rich glioma-inactivated protein 1 (LGI1), partial

Sign In for Pricing
View Details
Recombinant Human Leucine-rich glioma-inactivated protein 1 (LGI1), partial
RPC28443-02 100 µg

Recombinant Human Leucine-rich glioma-inactivated protein 1 (LGI1), partial

Sign In for Pricing
View Details
Recombinant Human Leucine-rich glioma-inactivated protein 1 (LGI1), partial
RPC28443-03 1 mg

Recombinant Human Leucine-rich glioma-inactivated protein 1 (LGI1), partial

Sign In for Pricing
View Details
OR5DE Polyclonal Antibody
JOT-AP12499-01 50ul

OR5DE Polyclonal Antibody

Sign In for Pricing
View Details