Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuroserpin Antibody

Neuroserpin is a protein that in humans is encoded by the SERPINI1 gene. This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in the regulation of axonal growth and the development of synaptic plasticity. Mutations in this gene result in familial encephalopathy with neuroserpin inclusion bodies (FENIB), which is a dominantly inherited form of familial encephalopathy and epilepsy characterized by the accumulation of mutant neuroserpin polymers. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

Q99574

Host

Rabbit

Reactivity

Human, Mouse, Rat

Immunogen

Amino acids KAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKA L of human Neuroserpin/SERPINI1 were used as the immunogen for the Neuroserpin antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the Neuroserpin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Neuroserpin antibody is available for research use only.

Storage Conditions

After reconstitution, the Neuroserpin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Neuroserpin antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat brain, 2) mouse brain, and 3) PANC lysate with Neuroserpin antibody. Expected/observed molecular weight ~46 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3 (Acetyl-K23) polyclonal antibody
BS70005-01 50 µL

Histone H3 (Acetyl-K23) polyclonal antibody

Sign In for Pricing
View Details
Histone H3 (Acetyl-K23) polyclonal antibody
BS70005-02 100 µL

Histone H3 (Acetyl-K23) polyclonal antibody

Sign In for Pricing
View Details
RAB27A Human Pre-designed siRNA Set A
HY-RS11537 1 Set

RAB27A Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
C1QC Human siRNA Oligo Duplex (Locus ID 714)
SR300495 1 Kit

C1QC Human siRNA Oligo Duplex (Locus ID 714)

Sign In for Pricing
View Details
Pancreatic Amylase Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-4030R-BF488-01 20 µL

Pancreatic Amylase Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Pancreatic Amylase Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-4030R-BF488-02 100 µL

Pancreatic Amylase Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details