Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

5HT2AR Antibody

The mammalian HTR2A (5-HT2A receptor) is a subtype of the 5-HT2 receptor that belongs to the serotonin receptor family and is a G protein-coupled receptor (GPCR) . This is the main excitatory receptor subtype among the GPCRs for serotonin (5-HT), although 5-HT2A may also have an inhibitory effect on certain areas such as the visual cortex and the orbit frontal cortex. This receptor was given importance first as the target of psychedelic drugs like LSD. Later it came back to prominence because it was also found to be mediating, at least partly, the action of many antipsychotic drugs, especially the atypical ones. 5-HT2A also happens to be a necessary receptor for the spread of the human polyoma virus called JC virus. Sparkes et al. (1991) concluded that the gene is located on 13q14-q21 in man and on chromosome 14 in the mouse.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 1-2 µg/mL

UniProt

P28223

Host

Rabbit

Reactivity

Human, Rat

Immunogen

Amino acids KENKKPLQLILVNTIPALAYKSSQLQMGQKKN of human 5HT2A Receptor were used as the immunogen for the 5HT2AR antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the 5HT2AR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This 5HT2AR antibody is available for research use only.

Storage Conditions

After reconstitution, the 5HT2AR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the 5HT2AR antibody should be determined by the researcher.

Image Legend

Western blot testing of 1) rat brain, 2) rat testis and 3) human U-87 MG lysate with 5HT2AR antibody. Predicted/observed molecular weight ~53 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTSA Rabbit Polyclonal Antibody
orb589394 100 µL

CTSA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NANOG polyclonal antibody
BS61798-01 50 µL

NANOG polyclonal antibody

Sign In for Pricing
View Details
NANOG polyclonal antibody
BS61798-02 100 µL

NANOG polyclonal antibody

Sign In for Pricing
View Details
Human Forkhead Box Protein O2 (FOXO2) ELISA Kit
MBS267776-01 48 Well

Human Forkhead Box Protein O2 (FOXO2) ELISA Kit

Sign In for Pricing
View Details
Human Forkhead Box Protein O2 (FOXO2) ELISA Kit
MBS267776-02 96 Well

Human Forkhead Box Protein O2 (FOXO2) ELISA Kit

Sign In for Pricing
View Details
Human Forkhead Box Protein O2 (FOXO2) ELISA Kit
MBS267776-03 5x 96 Well

Human Forkhead Box Protein O2 (FOXO2) ELISA Kit

Sign In for Pricing
View Details