Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Involucrin Antibody

Involucrin is a protein component of human skin and in humans is encoded by the IVL gene. It is a highly reactive, soluble, transglutaminase substrate protein present in keratinocytes of epidermisand other stratified squamous epithelia. It first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase thus helping in the formation of an insoluble envelope beneath the plasma membrane functioning as a glutamyl donor during assembly of the cornified envelope. Additionally, Involucrin is synthesised in the stratum spinosum and cross linked in the stratum granulosum by the transglutaminase enzyme that makes it highly stable. Thus it provides structural support to the cell, thereby allowing the cell to resist invasion by micro-organisms.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL

UniProt

P07476

Host

Rabbit

Reactivity

Human

Immunogen

Amino acids QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK of human Involucrin were used as the immunogen for the Involucrin antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the Involucrin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This Involucrin antibody is available for research use only.

Storage Conditions

After reconstitution, the Involucrin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the Involucrin antibody should be determined by the researcher.

Image Legend

Western blot testing of human 1) A431 and 2) A549 lysate with Involucrin antibody. Predicted molecular weight ~68 kDa but can be observed at up to ~140 kDa.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BATF2 Peptide - N-terminal region
MBS3233689-01 0.1 mg

BATF2 Peptide - N-terminal region

Sign In for Pricing
View Details
BATF2 Peptide - N-terminal region
MBS3233689-02 5x 0.1 mg

BATF2 Peptide - N-terminal region

Sign In for Pricing
View Details
Mouse Monoclonal Involucrin Antibody (SPM259) [Alexa Fluor 488]
NBP2-34402AF488 0.1 mL

Mouse Monoclonal Involucrin Antibody (SPM259) [Alexa Fluor 488]

Sign In for Pricing
View Details
Rat SIRT3 (Sirtuin 3) ELISA Kit
EK245639 96 Well

Rat SIRT3 (Sirtuin 3) ELISA Kit

Sign In for Pricing
View Details
SS18 Protein Vector (Mouse) (pPB-C-His)
PV234098 500 ng

SS18 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
LYK5 Polyclonal Antibody
bs-3949R 100 µL

LYK5 Polyclonal Antibody

Sign In for Pricing
View Details