Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP8 Antibody

MMP8 (Matrix metalloproteinase 8) is a member of the family of matrix metalloproteinases. It is distinct from the collagenase of skin fibroblasts and synovial cells in substrate specificity and immunologic crossreactivity. MMP8 is mapped to 11q21-q22. MMP8 is an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, is expressed by leukocytes and chorionic cytotrophoblast cells. The enzyme exhibits 58% homology to human fibroblast collagenase and has the same domain structure. It consists of a 20-residue signal peptide, and an 80-residue propeptide that is lost on autolytic activation by cleavage of an M-L bond. MMP8 was found to possess 57% identity with the deduced protein sequence for fibroblast collagenase with 72% chemical similarity. Matrix metalloproteinases (MMPs) have fundamental roles in tumor progression, but most clinical trials with MMP inhibitors have not shown improvements in individuals with cancer. MMP8 has a paradoxical protective role in cancer and provides a genetic model to evaluate the molecular basis of gender differences in cancer susceptibility.

Product Specifications

CAS Number

9007-83-4

Specifications

Western blot: 0.1-0.5 µg/mL, IHC (FFPE) : 0.5-1 µg/mL, ELISA: 0.1-0.5 µg/mL (mouse protein tested) ; request BSA-free format for coating

UniProt

O70138

Host

Rabbit

Reactivity

Mouse, Rat

Immunogen

Amino acids HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD of mouse MMP8 were used as the immunogen for the MMP8 antibody.

Clonality

Polyclonal

Isotype

IgG

Applications

WB, IHC-P, ELISA (protein)

Purity

Antigen affinity

Format

Antigen affinity purified

Buffer

Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide

Reconstitution

After reconstitution, the MMP8 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Limitations

This MMP8 antibody is available for research use only.

Storage Conditions

After reconstitution, the MMP8 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Formulation

0.5 mg/mL if reconstituted with 0.2ml sterile DI water

Applications Notes

Optimal dilution of the MMP8 antibody should be determined by the researcher.

Location

Cytoplasmic

Image Legend

Western blot testing of mouse 1) testis, 2) NIH3T3, 3) HEPA and 4) rat NRK cell lysate with MMP8 antibody. Expected molecular weight: 55 kDa (latent), 46, 42 kDa (active) .

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MA2 (PNMA2) (NM_007257) Human Over-expression Lysate
LC416096 20 µg

MA2 (PNMA2) (NM_007257) Human Over-expression Lysate

Sign In for Pricing
View Details
ADORA2B Antibody, FITC conjugated
A12033-50UG 50 µg

ADORA2B Antibody, FITC conjugated

Sign In for Pricing
View Details
TADA3L (TADA3) (NM_133480) Human Over-expression Lysate
E45H13651-2 20 µg

TADA3L (TADA3) (NM_133480) Human Over-expression Lysate

Sign In for Pricing
View Details
ADRA1A Rabbit pAb, BF555 conjugated
orb3125888 100 µL

ADRA1A Rabbit pAb, BF555 conjugated

Sign In for Pricing
View Details
WIF-1, Human (HEK293, His)
HY-P70982-01 5 µg

WIF-1, Human (HEK293, His)

Sign In for Pricing
View Details
WIF-1, Human (HEK293, His)
HY-P70982-02 10 µg

WIF-1, Human (HEK293, His)

Sign In for Pricing
View Details