Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WIF-1, Human (HEK293, His)

WIF-1 protein critically binds to WNT protein, inhibits its activity and regulates the WNT signaling pathway. In addition to its inhibitory role, WIF-1 may also contribute to mesoderm segmentation, implicating its role in embryonic development. WIF-1 Protein, Human (HEK293, His) is the recombinant human-derived WIF-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

WIF-1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/wif-1-protein-human-hek-293-his.html

Purity

97.60

Smiles

GPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIW

Molecular Formula

11197 (Gene_ID) AAH18037.1 (G29-W379) (Accession)

Molecular Weight

Approximately 42-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

AF9 (MLLT3, AF9, YEATS3, Protein AF-9, ALL1-fused Gene from Chromosome 9 Protein, Myeloid/Lymphoid or Mixed-lineage Leukemia Translocated to Chromosome 3 Protein, YEATS Domain-containing Protein 3, FLJ2035) (Biotin)
MBS6140512-01 0.1 mL

AF9 (MLLT3, AF9, YEATS3, Protein AF-9, ALL1-fused Gene from Chromosome 9 Protein, Myeloid/Lymphoid or Mixed-lineage Leukemia Translocated to Chromosome 3 Protein, YEATS Domain-containing Protein 3, FLJ2035) (Biotin)

Ask
View Details
AF9 (MLLT3, AF9, YEATS3, Protein AF-9, ALL1-fused Gene from Chromosome 9 Protein, Myeloid/Lymphoid or Mixed-lineage Leukemia Translocated to Chromosome 3 Protein, YEATS Domain-containing Protein 3, FLJ2035) (Biotin)
MBS6140512-02 5x 0.1 mL

AF9 (MLLT3, AF9, YEATS3, Protein AF-9, ALL1-fused Gene from Chromosome 9 Protein, Myeloid/Lymphoid or Mixed-lineage Leukemia Translocated to Chromosome 3 Protein, YEATS Domain-containing Protein 3, FLJ2035) (Biotin)

Ask
View Details
GENLISA™ Rat Prostaglandin E Receptor 2 (EP2) ELISA
KLR1329 1x 96 Well

GENLISA™ Rat Prostaglandin E Receptor 2 (EP2) ELISA

Ask
View Details
Peramivir trihydrate 5mg
A11531-5 5 mg

Peramivir trihydrate 5mg

Ask
View Details
p38 (phospho Tyr182) Antibody
A7179-01 50 μL

p38 (phospho Tyr182) Antibody

Ask
View Details
p38 (phospho Tyr182) Antibody
A7179-02 100 µL

p38 (phospho Tyr182) Antibody

Ask
View Details