Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Nucleoprotein (N)

Product Specifications

Product Name Alternative

Nucleocapsid protein; NC; Protein N

Abbreviation

Recombinant Bovine coronavirus N protein

Gene Name

N

UniProt

P26020

Expression Region

1-448aa

Organism

Bovine coronavirus (strain OK-0514) (BCoV) (BCV)

Target Sequence

MSFTPGKQSSSRASSGNRSGNGILKWADQSDQSRNVQTRGRRAQPKQTATSQQPSGGNVVPYYSWFSGITQFQKGKEFEFAEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVFWVASNQADVNTPADILDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRASSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVTKQTAKEIRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNLDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGQKNGQGENDNISVAAPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI

Tag

C-terminal 6xHis-tagged

Type

Developed Protein & Coronavirus Protein

Source

Mammalian cell

Field of Research

Microbiology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

51.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL-6 CF
206-IL-050/CF 50 µg

Recombinant Human IL-6 CF

Sign In for Pricing
View Details
Anti-ERVFRD-1 Antibody
STJ503176 100 µg

Anti-ERVFRD-1 Antibody

Sign In for Pricing
View Details
Osteopontin (SPP1) Mouse Monoclonal Antibody [Clone ID: LBI5E4]
AMM17476VCF 100 µg

Osteopontin (SPP1) Mouse Monoclonal Antibody [Clone ID: LBI5E4]

Sign In for Pricing
View Details
Olr178 (NM_001000179) Rat Tagged ORF Clone Lentiviral Particle
RR215480L3V 200 µL

Olr178 (NM_001000179) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Hoxa10, ID (Hoxa10, Hox-1.8, Hoxa-10, Homeobox protein Hox-A10, Homeobox protein Hox-1.8) (PE)
MBS6307659-01 0.2 mL

Hoxa10, ID (Hoxa10, Hox-1.8, Hoxa-10, Homeobox protein Hox-A10, Homeobox protein Hox-1.8) (PE)

Sign In for Pricing
View Details
Hoxa10, ID (Hoxa10, Hox-1.8, Hoxa-10, Homeobox protein Hox-A10, Homeobox protein Hox-1.8) (PE)
MBS6307659-02 5x 0.2 mL

Hoxa10, ID (Hoxa10, Hox-1.8, Hoxa-10, Homeobox protein Hox-A10, Homeobox protein Hox-1.8) (PE)

Sign In for Pricing
View Details