Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRPX2, Mouse (Myc, His-SUMO)

The SRPX2 protein is a ligand for the urokinase plasminogen activator surface receptor and promotes angiogenesis by inducing endothelial cell migration and vascular network formation. It also exerts critical effects on cell migration and adhesion, increases FAK phosphorylation and enhances HGF mitogenic activity. SRPX2 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived SRPX2 protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

SRPX2 Protein, Mouse (Myc, His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/srpx2-protein-mouse-myc-his-sumo.html

Purity

90.00

Smiles

WYAGSGYSPDESYNEVYAEEVPAARARALDYRVPRWCYTLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRKSVQCLPSRRWSGTAYCRQIRCHTLPFITSGTYTCTNGMLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPILKPPQHGYLTCSSAGDNYGAICEYHCDGGYERQGTPSRVCQSSRQWSGTPPVCTPMKINVNVNSAAGLLDQFYEKQRLLIVSAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSAGIIEELRQFQRLTRSYFNMVLIDKQGIDRERYMEPVTPEEIFTFIDDYLLSNEELARRVEQRDLCE

Molecular Formula

68792 (Gene_ID) Q8R054 (W26-E468) (Accession)

Molecular Weight

Approximately 70.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C21orf58 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-9978R-BF488 100 µL

C21orf58 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Human IL-1RA/IL1RN PicoKine® Quick ELISA Kit
FEK0782 96 Well With Removable Strips

Human IL-1RA/IL1RN PicoKine® Quick ELISA Kit

Sign In for Pricing
View Details
FPR3 ORF Vector (Human) (pORF)
20814011 1.0 µg DNA

FPR3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Cyp2b23 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3008703 1.0 µg DNA

Cyp2b23 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
anti-PDXK.1
YF-PA15713 50 ul

anti-PDXK.1

Sign In for Pricing
View Details
Fibroblast Complete Culture Medium (kit)
F1745 500 mL

Fibroblast Complete Culture Medium (kit)

Sign In for Pricing
View Details