Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPAR gamma, Human (C-His, solution)

The PPAR gamma protein is a nuclear receptor that binds to peroxisome proliferators and is activated upon ligand binding to specific PPREs on DNA. It regulates target gene transcription and controls fatty acid metabolism. PPAR gamma Protein, Human (C-His, solution) is the recombinant human-derived PPAR gamma protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PPAR gamma Protein, Human (C-His, solution), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ppar-gamma-protein-human-c-his.html

Purity

93.00

Smiles

DLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKD

Molecular Formula

5468 (Gene_ID) P37231-1 (D238-D503) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oxytocin R Polyclonal Antibody, PE-Cy7 Conjugated
bs-1314R-PE-Cy7 100 µL

Oxytocin R Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
MMP17 Recombinant Antibody, PE-Cy5.5 Conjugated
bsm-61845R-PE-Cy5.5 100 µL

MMP17 Recombinant Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
SPTBN1 polyclonal antibody
BS71517-01 50 µL

SPTBN1 polyclonal antibody

Sign In for Pricing
View Details
SPTBN1 polyclonal antibody
BS71517-02 100 µL

SPTBN1 polyclonal antibody

Sign In for Pricing
View Details
Atp6v1c1 3'UTR Lenti-reporter-Luc Vector
12789086 1.0 µg

Atp6v1c1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PAC-1 CRISPR Activation Plasmid (m)
sc-420079-ACT 20 µg

PAC-1 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details