Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E3 ubiquitin-protein ligase RNF182 (RNF182), partial

Product Specifications

Product Name Alternative

RING finger protein 182; RING-type E3 ubiquitin transferase RNF182

Abbreviation

Recombinant Human RNF182 protein, partial

Gene Name

RNF182

UniProt

Q8N6D2

Expression Region

1-183aa

Organism

Homo sapiens (Human)

Target Sequence

MASQPPEDTAESQASDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKKCLPENPTELLLTPKRLASLVSPSHTSSNCLVITIMEVQRESSPSLSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIR

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

E3 ubiquitin-protein ligase that mediates the ubiquitination of ATP6V0C and targets it to degradation via the ubiquitin-proteasome pathway. Also plays a role in the inhibition of TLR-triggered innate immune response by mediating 'Lys'-48-linked ubiquitination and subsequent degradation of NF-kappa-B component RELA.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Lat2 shRNA (UAS) - Lentiviral mouse Lat2 shRNA (UAS, iRFP) (25)
GTR15286298 1 Vial

Lentiviral mouse Lat2 shRNA (UAS) - Lentiviral mouse Lat2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Car5b Protein Vector (Rat) (pPB-N-His)
PV257515 500 ng

Car5b Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Il6st Mouse qPCR Primer Pair (NM_010560)
MP206800 200 Reactions

Il6st Mouse qPCR Primer Pair (NM_010560)

Sign In for Pricing
View Details
CTSE Rabbit pAb (APR24906N)
APR24906N-01 50 µL

CTSE Rabbit pAb (APR24906N)

Sign In for Pricing
View Details
CTSE Rabbit pAb (APR24906N)
APR24906N-02 100 µL

CTSE Rabbit pAb (APR24906N)

Sign In for Pricing
View Details
CTSE Rabbit pAb (APR24906N)
APR24906N-03 200 µL

CTSE Rabbit pAb (APR24906N)

Sign In for Pricing
View Details