Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Rhesus Macaque (HEK293, His)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD79B protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-rhesus-macaque-hek-293-his.html

Purity

95.93

Smiles

AKSEDLYPNPKGSACSRIWQSPRFIARKRGFTVKMHCYVTNSTFSIVSWLRKRETDKEPQQVNLEQGHMHQTQNSSVTTLIIQDIRFEDNGIYFCQQECSKTSEVYRGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

718218 (Gene_ID) H9ZFT8 (A30-D161) (Accession)

Molecular Weight

20-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD101 Protein (N-His, Mus musculus (Mouse) )
P501381 100 µg

CD101 Protein (N-His, Mus musculus (Mouse) )

Sign In for Pricing
View Details
PGM2L1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F5]
TA812137AM 100 µL

PGM2L1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F5]

Sign In for Pricing
View Details
B2-Microglobulin (b2M) (Biotin)
M3890-10-Biotin 100 µL

B2-Microglobulin (b2M) (Biotin)

Sign In for Pricing
View Details
Cyclofos-6
MPD0102K Each

Cyclofos-6

Sign In for Pricing
View Details
Hsa-miR-1306-3p agomir
HY-R00237A-01 5 nmol

Hsa-miR-1306-3p agomir

Sign In for Pricing
View Details
Hsa-miR-1306-3p agomir
HY-R00237A-02 20 nmol

Hsa-miR-1306-3p agomir

Sign In for Pricing
View Details