Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Rhesus Macaque (HEK293, His)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD79B protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-rhesus-macaque-hek-293-his.html

Purity

95.93

Smiles

AKSEDLYPNPKGSACSRIWQSPRFIARKRGFTVKMHCYVTNSTFSIVSWLRKRETDKEPQQVNLEQGHMHQTQNSSVTTLIIQDIRFEDNGIYFCQQECSKTSEVYRGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

718218 (Gene_ID) H9ZFT8 (A30-D161) (Accession)

Molecular Weight

20-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Huntingtin (HTT) (NM_002111) Human Over-expression Lysate
LY419529 100 µg

Huntingtin (HTT) (NM_002111) Human Over-expression Lysate

Sign In for Pricing
View Details
PIWIL1 Antibody
GWB-MN779E 50 µg

PIWIL1 Antibody

Sign In for Pricing
View Details
Tacky Mat 48 x 110cm Grey
CLE4068 4 / PCK

Tacky Mat 48 x 110cm Grey

Sign In for Pricing
View Details
HIC5 (TGFB1I1) Human siRNA Oligo Duplex (Locus ID 7041)
SR304806 1 Kit

HIC5 (TGFB1I1) Human siRNA Oligo Duplex (Locus ID 7041)

Sign In for Pricing
View Details
Atoh7 (NM_016864) Mouse Tagged Lenti ORF Clone
MR222842L4 10 µg

Atoh7 (NM_016864) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Duck Heme oxygenase 1 (HMOX1) ELISA Kit
MBS2802580-01 48 Tests

Duck Heme oxygenase 1 (HMOX1) ELISA Kit

Sign In for Pricing
View Details