Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Rhesus Macaque (HEK293, His)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD79B protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-rhesus-macaque-hek-293-his.html

Purity

95.93

Smiles

AKSEDLYPNPKGSACSRIWQSPRFIARKRGFTVKMHCYVTNSTFSIVSWLRKRETDKEPQQVNLEQGHMHQTQNSSVTTLIIQDIRFEDNGIYFCQQECSKTSEVYRGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

718218 (Gene_ID) H9ZFT8 (A30-D161) (Accession)

Molecular Weight

20-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Abhd10 Mouse Gene Knockout Kit (CRISPR)
KN500646 1 Kit

Abhd10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
pUNO1Fc-SARS2-S1
p1fc-cov2-s1 20 µg

pUNO1Fc-SARS2-S1

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Cytochrome c1, heme protein, mitochondrial (cyt1), partial
MBS7070600 Inquire

Recombinant Schizosaccharomyces pombe Cytochrome c1, heme protein, mitochondrial (cyt1), partial

Sign In for Pricing
View Details
pOTB7-TRIB3 Plasmid
PVT40478 2 µg

pOTB7-TRIB3 Plasmid

Sign In for Pricing
View Details
TJAP1 (NM_080604) Human Tagged ORF Clone Lentiviral Particle
RC209031L4V 200 µL

TJAP1 (NM_080604) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human PHF3 Protein, His (Fc)-Avi-tagged
PHF3-3847H 50 µg

Recombinant Human PHF3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details