Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Rhesus Macaque (HEK293, His)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD79B protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-rhesus-macaque-hek-293-his.html

Purity

95.93

Smiles

AKSEDLYPNPKGSACSRIWQSPRFIARKRGFTVKMHCYVTNSTFSIVSWLRKRETDKEPQQVNLEQGHMHQTQNSSVTTLIIQDIRFEDNGIYFCQQECSKTSEVYRGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

718218 (Gene_ID) H9ZFT8 (A30-D161) (Accession)

Molecular Weight

20-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOSTRIN (NM_001171632) Human Tagged Lenti ORF Clone
RC230143L4 10 µg

NOSTRIN (NM_001171632) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Ifltd1 3'UTR GFP Stable Cell Line
TU159918 1.0 mL

Ifltd1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Abraxas Recombinant Protein Antigen
NBP2-38356PEP 0.1 mL

Abraxas Recombinant Protein Antigen

Sign In for Pricing
View Details
OR7E90P sgRNA CRISPR Lentivector (Human) (Target 1)
K1537202 1.0 µg DNA

OR7E90P sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rabbit Polyclonal AADACL4 Antibody [DyLight 350]
NBP3-06223UV 0.1 mL

Rabbit Polyclonal AADACL4 Antibody [DyLight 350]

Sign In for Pricing
View Details
BRINP2 siRNA (Human)
CRJ1676-01 15 nmol

BRINP2 siRNA (Human)

Sign In for Pricing
View Details