Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B, Rhesus Macaque (HEK293, His)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD79B protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD79B Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd79b-protein-rhesus-macaque-hek-293-his.html

Purity

95.93

Smiles

AKSEDLYPNPKGSACSRIWQSPRFIARKRGFTVKMHCYVTNSTFSIVSWLRKRETDKEPQQVNLEQGHMHQTQNSSVTTLIIQDIRFEDNGIYFCQQECSKTSEVYRGCGTELRVMGFSTLAQLKQRNTLKD

Molecular Formula

718218 (Gene_ID) H9ZFT8 (A30-D161) (Accession)

Molecular Weight

20-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SENP1 Antibody
A70476-100UG 100 µg

SENP1 Antibody

Sign In for Pricing
View Details
Human Polymerase DNA Directed Alpha 1 (POLa1) Antibody Pair Kit (with Standard)
MBS2101972-01 5x 96 Tests

Human Polymerase DNA Directed Alpha 1 (POLa1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Polymerase DNA Directed Alpha 1 (POLa1) Antibody Pair Kit (with Standard)
MBS2101972-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Polymerase DNA Directed Alpha 1 (POLa1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Polymerase DNA Directed Alpha 1 (POLa1) Antibody Pair Kit (with Standard)
MBS2101972-03 10x 96 Tests

Human Polymerase DNA Directed Alpha 1 (POLa1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Polymerase DNA Directed Alpha 1 (POLa1) Antibody Pair Kit (with Standard)
MBS2101972-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Human Polymerase DNA Directed Alpha 1 (POLa1) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
RASIP1 Rabbit pAb
MBS9143356-01 0.02 mL

RASIP1 Rabbit pAb

Sign In for Pricing
View Details