CD79B, Rhesus Macaque (HEK293, His)
CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD79B protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CD79B Protein, Rhesus Macaque (HEK293, His), Rhesus Macaque, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd79b-protein-rhesus-macaque-hek-293-his.html
Purity
95.93
Smiles
AKSEDLYPNPKGSACSRIWQSPRFIARKRGFTVKMHCYVTNSTFSIVSWLRKRETDKEPQQVNLEQGHMHQTQNSSVTTLIIQDIRFEDNGIYFCQQECSKTSEVYRGCGTELRVMGFSTLAQLKQRNTLKD
Molecular Formula
718218 (Gene_ID) H9ZFT8 (A30-D161) (Accession)
Molecular Weight
20-30 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
Human Sex-determining region Y protein (SRY) ELISA Kit
MIP3B, CT (C-C Motif Chemokine 19, Small Inducible Cytokine A19, Macrophage Inflammatory Protein 3 beta, MIP-3-beta, Epstein-Barr Virus-induced Molecule 1 Ligand Chemokine, EBI1-ligand Chemokine, ELC, Beta Chemokine Exodus-3, CK beta-11, CCL19, SCYA19) (MaxLight 405) discontinued
AVEN, NT (AVEN, Cell death regulator Aven) (MaxLight 750)
AVEN, NT (AVEN, Cell death regulator Aven) (MaxLight 750)