Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Azotobacter vinelandii Uncharacterized protein

Product Specifications

Abbreviation

Recombinant Azotobacter vinelandii Uncharacterized protein

UniProt

C1DPA0

Expression Region

1-133aa

Organism

Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

Target Sequence

MSVREAGQKGGEIRKEQLGPEGYSELGHKGGEARKEQLGPEGYSELGHKGGEARKEQLGPEGYSELGKKGGEARKEQLGPEGYSELGHKGGQRVRELIEEGKRAEGQQGSQGGKQENRGQSRQEDQDKGSRKS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1R,3S)-3-Aminocyclopentanol Hydrochloride
TRC-A596540-25MG 25 mg

(1R,3S)-3-Aminocyclopentanol Hydrochloride

Sign In for Pricing
View Details
Biotinylated Rhesus macaque Mamu-A*08&B2M Monomer Protein (Peptide free, MALS verified)
MAM-R82E5-25ug 25 µg

Biotinylated Rhesus macaque Mamu-A*08&B2M Monomer Protein (Peptide free, MALS verified)

Sign In for Pricing
View Details
ZNF205 (NM_001042428) Human Over-expression Lysate
LC420898 20 µg

ZNF205 (NM_001042428) Human Over-expression Lysate

Sign In for Pricing
View Details
ADAR1 (ADAR) (NM_001025107) Human Over-expression Lysate
LY425483 100 µg

ADAR1 (ADAR) (NM_001025107) Human Over-expression Lysate

Sign In for Pricing
View Details
Tylosin Phosphate
TRC-T947662-2.5G 2.5 g

Tylosin Phosphate

Sign In for Pricing
View Details
Ccdc157 Mouse Gene Knockout Kit (CRISPR)
KN502674 1 Kit

Ccdc157 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details