Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-G, Human (His-SUMO)

HLA-G is a nonclassical major histocompatibility class Ib molecule that is critical for immune regulation at the maternal-fetal interface. It cooperates with B2M to form a complex that selectively binds self-peptides to promote maternal-fetal tolerance by interacting with KIR2DL4, LILRB1, and LILRB2 receptors. HLA-G Protein, Human (His-SUMO) is the recombinant human-derived HLA-G protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

HLA-G Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hla-g-protein-human-his-sumo.html

Smiles

GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Molecular Formula

3135 (Gene_ID) P17693-1 (G25-D338) (Accession)

Molecular Weight

Approximately 51.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calreticulin Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-42141R-BF488 100 µL

Calreticulin Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
BEND2 Lentiviral Activation Particles (h2)
sc-414461-LAC-2 200 µL

BEND2 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
PRELID2 (NM_138492) Human Tagged ORF Clone
RC204565 10 µg

PRELID2 (NM_138492) Human Tagged ORF Clone

Sign In for Pricing
View Details
PXR Ligand 2
HY-169280 1 Each

PXR Ligand 2

Sign In for Pricing
View Details
Rat BPI Fold-Containing Family B Member 3 (BPIFB3) ELISA Kit
abx503974 96 Tests

Rat BPI Fold-Containing Family B Member 3 (BPIFB3) ELISA Kit

Sign In for Pricing
View Details
3BHS2 Polyclonal Antibody
MBS8529686-01 0.1 mg

3BHS2 Polyclonal Antibody

Sign In for Pricing
View Details