Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIC3, Human (His)

The CLIC3 protein is a multifunctional molecule capable of integrating into membranes and forming chloride channels. It has been implicated in potential roles related to cell growth control. CLIC3 Protein, Human (His) is the recombinant human-derived CLIC3 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CLIC3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clic3-protein-human-his.html

Purity

98.0

Smiles

MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR

Molecular Formula

9022 (Gene_ID) O95833 (M1-R236) (Accession)

Molecular Weight

Approximately 31 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRGM Antibody (C-term)
E45R08031G-1 100 µL

IRGM Antibody (C-term)

Sign In for Pricing
View Details
UGGT1 Conjugated Antibody
orb1616548 100 µL

UGGT1 Conjugated Antibody

Sign In for Pricing
View Details
ZNF670 (Zinc Finger Protein 670)
496734 100 µL

ZNF670 (Zinc Finger Protein 670)

Sign In for Pricing
View Details
Anti-CD40 [A54 scFv]
MBS488460-01 0.2 mg

Anti-CD40 [A54 scFv]

Sign In for Pricing
View Details
Anti-CD40 [A54 scFv]
MBS488460-02 5x 0.2 mg

Anti-CD40 [A54 scFv]

Sign In for Pricing
View Details
1- (4-Trifluoromethylbenzyl) piperazine
FT75444-01 1 g

1- (4-Trifluoromethylbenzyl) piperazine

Sign In for Pricing
View Details