CD30/TNFRSF8, Human (HEK293, His)
CD30/TNFRSF8 protein (TNFSF8/CD30L receptor) is a key factor regulating cell growth and lymphoblast transformation and may activate NF-kappa-B signaling. CD30/TNFRSF8 Protein, Human (HEK293, His) is the recombinant human-derived CD30/TNFRSF8 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CD30/TNFRSF8 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd30-protein-human-hek-293-his.html
Purity
98.0
Smiles
FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK
Molecular Formula
943 (Gene_ID) P28908 (F19-K379) (Accession)
Molecular Weight
60-95 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7180168 Inquire
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) MUG84 Polyclonal Antibody
Sign In for Pricing
View Details 
MBS7210553-01 48 Well
Rabbit Olfactory receptor 51E1 (OR51E1) ELISA Kit
Sign In for Pricing
View Details MBS7210553-02 96 Well
Rabbit Olfactory receptor 51E1 (OR51E1) ELISA Kit
Sign In for Pricing
View Details MBS7210553-03 5x 96 Well
Rabbit Olfactory receptor 51E1 (OR51E1) ELISA Kit
Sign In for Pricing
View Details MBS7210553-04 10x 96 Well
Rabbit Olfactory receptor 51E1 (OR51E1) ELISA Kit
Sign In for Pricing
View Details