CD59, Cynomolgus (HEK293, His)
The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and exerts regulatory control at or after the C5b-8 stage. Its critical role makes CD59 a key regulator in the complement system, preventing overactivation and associated membrane damage. CD59 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD59 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
CD59 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd59-protein-cynomolgus-hek293-his.html
Purity
95.0
Smiles
LQCYNCPNPTTDCKTAINCSSGFDTCLIARAGLQVYNQCWKFANCNYNDISTLLKESELRYFCCKKDLCNFNEQLE
Molecular Formula
101867071 (Gene_ID) G7PQF7 (L26-E101) (Accession)
Molecular Weight
Approximately 9&16-18 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
WISP2, ID (WNT1-inducible-signaling Pathway Protein 2, WISP-2, Connective Tissue Growth Factor-like Protein, CTGF-L, Connective Tissue Growth Factor-related Protein 58, CCN Family Member 5, CCN5, CT58, CTGFL, UNQ228/PRO261) (PE) discontinued
Recombinant Human Procalcitonin Protein, Untagged, E.coli-1mg
Multi-Pulse Vortexer base, with cartridges for 12-13mm and 15-16mm tubes. 100 - 2000rpm, 240V, CE