Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOLR2, Human (HEK293, His)

FOLR2 Protein binds folate, enabling the transport of 5-methyltetrahydrofolate into cells with high affinity under neutral pH. Upon endocytosis, exposure to slightly acidic pH induces a conformational change, substantially reducing FOLR2's folate affinity and releasing it from the receptor. FOLR2 Protein, Human (HEK293, His) is the recombinant human-derived FOLR2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

FOLR2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/folr2-protein-human-hek293-his.html

Purity

97.0

Smiles

TMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMH

Molecular Formula

2350 (Gene_ID) P14207 (T17-H228) (Accession)

Molecular Weight

Approximately 28-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human AP3b1 (Adaptor Related Protein Complex 3 Beta 1) ELISA Kit
EH24618 96 Tests

Human AP3b1 (Adaptor Related Protein Complex 3 Beta 1) ELISA Kit

Sign In for Pricing
View Details
LDLRAD2 Antibody
E51A01918 100 µL

LDLRAD2 Antibody

Sign In for Pricing
View Details
Human C2orf88 qPCR Primer Pair
QH55649S 200 Tests

Human C2orf88 qPCR Primer Pair

Sign In for Pricing
View Details
Cathepsin L/V/K/H Rabbit pAb
E45R18873N-100 100 µL

Cathepsin L/V/K/H Rabbit pAb

Sign In for Pricing
View Details
Lentiviral mouse Cpne9 shRNA (UAS) - Lentiviral mouse Cpne9 shRNA (UAS, RFP) (100)
GTR15154188 1 Vial

Lentiviral mouse Cpne9 shRNA (UAS) - Lentiviral mouse Cpne9 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
HCG9P1 sgRNA CRISPR Lentivector set (Human)
K0935401 3x 1.0 µg

HCG9P1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details