Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOLR2, Human (HEK293, His)

FOLR2 Protein binds folate, enabling the transport of 5-methyltetrahydrofolate into cells with high affinity under neutral pH. Upon endocytosis, exposure to slightly acidic pH induces a conformational change, substantially reducing FOLR2's folate affinity and releasing it from the receptor. FOLR2 Protein, Human (HEK293, His) is the recombinant human-derived FOLR2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

FOLR2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/folr2-protein-human-hek293-his.html

Purity

97.0

Smiles

TMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMH

Molecular Formula

2350 (Gene_ID) P14207 (T17-H228) (Accession)

Molecular Weight

Approximately 28-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CD21/CR2 & CR1L Protein, C-His
MBS1578780-01 0.1 mg

Recombinant Mouse CD21/CR2 & CR1L Protein, C-His

Sign In for Pricing
View Details
Recombinant Mouse CD21/CR2 & CR1L Protein, C-His
MBS1578780-02 1 mg

Recombinant Mouse CD21/CR2 & CR1L Protein, C-His

Sign In for Pricing
View Details
Recombinant Mouse CD21/CR2 & CR1L Protein, C-His
MBS1578780-03 5x 1 mg

Recombinant Mouse CD21/CR2 & CR1L Protein, C-His

Sign In for Pricing
View Details
Chicken Hyaluronan synthase 3, HAS3 ELISA Kit
MBS9304948 Inquire

Chicken Hyaluronan synthase 3, HAS3 ELISA Kit

Sign In for Pricing
View Details
RFWD3 Lentiviral Activation Particles (h2)
sc-407805-LAC-2 200 µL

RFWD3 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae Outer membrane protein C (ompC)
MBS1462847-01 0.02 mg (E-Coli)

Recombinant Klebsiella pneumoniae Outer membrane protein C (ompC)

Sign In for Pricing
View Details