Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOLR2, Human (HEK293, His)

FOLR2 Protein binds folate, enabling the transport of 5-methyltetrahydrofolate into cells with high affinity under neutral pH. Upon endocytosis, exposure to slightly acidic pH induces a conformational change, substantially reducing FOLR2's folate affinity and releasing it from the receptor. FOLR2 Protein, Human (HEK293, His) is the recombinant human-derived FOLR2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

FOLR2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/folr2-protein-human-hek293-his.html

Purity

97.0

Smiles

TMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMH

Molecular Formula

2350 (Gene_ID) P14207 (T17-H228) (Accession)

Molecular Weight

Approximately 28-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VASH1 sgRNA CRISPR Lentivector (Human) (Target 2)
K2605703 1.0 µg DNA

VASH1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Recombinant Mycobacterium Ulcerans pdxT Protein (aa 1-198)
VAng-Yyj4132-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Ulcerans pdxT Protein (aa 1-198)

Sign In for Pricing
View Details
SERAC1 HDR Plasmid (m)
sc-435852-HDR 20 µg

SERAC1 HDR Plasmid (m)

Sign In for Pricing
View Details
Integrin αX Lentiviral Activation Particles (h)
sc-401765-LAC 200 µL

Integrin αX Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
hsa-miR-6848-5p miRNA Inhibitor
MBS8295159-01 10 nmol

hsa-miR-6848-5p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-6848-5p miRNA Inhibitor
MBS8295159-02 20 nmol

hsa-miR-6848-5p miRNA Inhibitor

Sign In for Pricing
View Details