Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOLR2, Human (HEK293, His)

FOLR2 Protein binds folate, enabling the transport of 5-methyltetrahydrofolate into cells with high affinity under neutral pH. Upon endocytosis, exposure to slightly acidic pH induces a conformational change, substantially reducing FOLR2's folate affinity and releasing it from the receptor. FOLR2 Protein, Human (HEK293, His) is the recombinant human-derived FOLR2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

FOLR2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/folr2-protein-human-hek293-his.html

Purity

97.0

Smiles

TMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMH

Molecular Formula

2350 (Gene_ID) P14207 (T17-H228) (Accession)

Molecular Weight

Approximately 28-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Annexin A5 Protein, His Tag
AN5-H5123-1mg 1 mg

Human Annexin A5 Protein, His Tag

Sign In for Pricing
View Details
YWHAZ Recombinant Monoclonal Antibody
RAC08148-01 50 µL

YWHAZ Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
YWHAZ Recombinant Monoclonal Antibody
RAC08148-02 100 µL

YWHAZ Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
Grsf1 (NM_178700) Mouse Tagged ORF Clone Lentiviral Particle
MR216357L4V 200 µL

Grsf1 (NM_178700) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Coatomer subunit delta (ARCN1) (NM_001655) Human Mass Spec Standard
PH310778 10 µg

Coatomer subunit delta (ARCN1) (NM_001655) Human Mass Spec Standard

Sign In for Pricing
View Details
Bri3bp Mouse siRNA Oligo Duplex (Locus ID 76809)
SR407141 1 Kit

Bri3bp Mouse siRNA Oligo Duplex (Locus ID 76809)

Sign In for Pricing
View Details