Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOLR2, Human (HEK293, His)

FOLR2 Protein binds folate, enabling the transport of 5-methyltetrahydrofolate into cells with high affinity under neutral pH. Upon endocytosis, exposure to slightly acidic pH induces a conformational change, substantially reducing FOLR2's folate affinity and releasing it from the receptor. FOLR2 Protein, Human (HEK293, His) is the recombinant human-derived FOLR2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

FOLR2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/folr2-protein-human-hek293-his.html

Purity

97.0

Smiles

TMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMH

Molecular Formula

2350 (Gene_ID) P14207 (T17-H228) (Accession)

Molecular Weight

Approximately 28-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAY-678 100mg
A16866-100 100 mg

BAY-678 100mg

Sign In for Pricing
View Details
Human Ectonucleotide pyrophosphatase,phosphodiesterase family member 1 (ENPP1) Elisa Kit
EK712175 96 Well

Human Ectonucleotide pyrophosphatase,phosphodiesterase family member 1 (ENPP1) Elisa Kit

Sign In for Pricing
View Details
Screwthread Adapter
2068612/1 1 Each

Screwthread Adapter

Sign In for Pricing
View Details
Tau isoform 4 Monoclonal Antibody, PE-Cy7 Conjugated
bsm-41802M-PE-Cy7 100 µL

Tau isoform 4 Monoclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal NLRP3/NALP3 Antibody (25N10E9) [Alexa Fluor 647]
NBP2-03948AF647 0.1 mL

Mouse Monoclonal NLRP3/NALP3 Antibody (25N10E9) [Alexa Fluor 647]

Sign In for Pricing
View Details
DKK3, NT (Dickkopf-related Protein 3, Dickkopf-3, Dkk-3, REIC, NQ258/PRO295)
MBS626275-01 0.2 mL

DKK3, NT (Dickkopf-related Protein 3, Dickkopf-3, Dkk-3, REIC, NQ258/PRO295)

Sign In for Pricing
View Details