Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOLR2, Human (HEK293, His)

FOLR2 Protein binds folate, enabling the transport of 5-methyltetrahydrofolate into cells with high affinity under neutral pH. Upon endocytosis, exposure to slightly acidic pH induces a conformational change, substantially reducing FOLR2's folate affinity and releasing it from the receptor. FOLR2 Protein, Human (HEK293, His) is the recombinant human-derived FOLR2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

FOLR2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/folr2-protein-human-hek293-his.html

Purity

97.0

Smiles

TMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMH

Molecular Formula

2350 (Gene_ID) P14207 (T17-H228) (Accession)

Molecular Weight

Approximately 28-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAQR5 Protein Vector (Rat) (pPB-N-His)
PV292387 500 ng

PAQR5 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Anti-CD45 Antibody, Mouse Monoclonal
MBS8101643-01 0.1 mL

Anti-CD45 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Anti-CD45 Antibody, Mouse Monoclonal
MBS8101643-02 5x 0.1 mL

Anti-CD45 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Dnaj Homolog Subfamily B Member 2 (HSPF3) Antibody
abx404978-01 100 µL

Dnaj Homolog Subfamily B Member 2 (HSPF3) Antibody

Sign In for Pricing
View Details
Dnaj Homolog Subfamily B Member 2 (HSPF3) Antibody
abx404978-02 200 µL

Dnaj Homolog Subfamily B Member 2 (HSPF3) Antibody

Sign In for Pricing
View Details
Dnaj Homolog Subfamily B Member 2 (HSPF3) Antibody
abx404978-03 1 mL

Dnaj Homolog Subfamily B Member 2 (HSPF3) Antibody

Sign In for Pricing
View Details