Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOLR2, Human (HEK293, His)

FOLR2 Protein binds folate, enabling the transport of 5-methyltetrahydrofolate into cells with high affinity under neutral pH. Upon endocytosis, exposure to slightly acidic pH induces a conformational change, substantially reducing FOLR2's folate affinity and releasing it from the receptor. FOLR2 Protein, Human (HEK293, His) is the recombinant human-derived FOLR2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

FOLR2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/folr2-protein-human-hek293-his.html

Purity

97.0

Smiles

TMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMH

Molecular Formula

2350 (Gene_ID) P14207 (T17-H228) (Accession)

Molecular Weight

Approximately 28-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MYH2 Antibody
ANT-36176-100ug 100 µg

Human MYH2 Antibody

Sign In for Pricing
View Details
PEPD (Xaa-Pro dipeptidase) BioAssayTM ELISA Kit (Human) discontinued
358027-01 48 Tests

PEPD (Xaa-Pro dipeptidase) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
PEPD (Xaa-Pro dipeptidase) BioAssayTM ELISA Kit (Human) discontinued
358027-02 96 Tests

PEPD (Xaa-Pro dipeptidase) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
MXD3 Antibody, HRP conjugated
A29154-100UG 100 µg

MXD3 Antibody, HRP conjugated

Sign In for Pricing
View Details
OR52I2 (NM_001005170) Human Over-expression Lysate
LY423956 100 µg

OR52I2 (NM_001005170) Human Over-expression Lysate

Sign In for Pricing
View Details
TH1L Recombinant Protein Antigen
NBP2-55400PEP 100 µL

TH1L Recombinant Protein Antigen

Sign In for Pricing
View Details