Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOLR2, Human (HEK293, His)

FOLR2 Protein binds folate, enabling the transport of 5-methyltetrahydrofolate into cells with high affinity under neutral pH. Upon endocytosis, exposure to slightly acidic pH induces a conformational change, substantially reducing FOLR2's folate affinity and releasing it from the receptor. FOLR2 Protein, Human (HEK293, His) is the recombinant human-derived FOLR2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

FOLR2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/folr2-protein-human-hek293-his.html

Purity

97.0

Smiles

TMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMH

Molecular Formula

2350 (Gene_ID) P14207 (T17-H228) (Accession)

Molecular Weight

Approximately 28-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plpp1 (NM_022538) Rat Tagged ORF Clone
RR209860 10 µg

Plpp1 (NM_022538) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Sodium Butyrate for cell culture, 99%, Endotoxin (BET) 1.0EU/mg
16670-1 100 Gms

Sodium Butyrate for cell culture, 99%, Endotoxin (BET) 1.0EU/mg

Sign In for Pricing
View Details
XAF1 Rabbit Polyclonal Antibody
AP07806PU-N 50 µg

XAF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Hnrpk (BC006694) Mouse Tagged ORF Clone
MR207407 10 µg

Hnrpk (BC006694) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ZR-96 BashingBead™ Lysis Rack (Double barcoded Tubes) (1x96)
S6002-96-5 1 PC

ZR-96 BashingBead™ Lysis Rack (Double barcoded Tubes) (1x96)

Sign In for Pricing
View Details
Hexdc (NM_001001333) Mouse Tagged ORF Clone
MR207466 10 µg

Hexdc (NM_001001333) Mouse Tagged ORF Clone

Sign In for Pricing
View Details