Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOLR2, Human (HEK293, His)

FOLR2 Protein binds folate, enabling the transport of 5-methyltetrahydrofolate into cells with high affinity under neutral pH. Upon endocytosis, exposure to slightly acidic pH induces a conformational change, substantially reducing FOLR2's folate affinity and releasing it from the receptor. FOLR2 Protein, Human (HEK293, His) is the recombinant human-derived FOLR2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

FOLR2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/folr2-protein-human-hek293-his.html

Purity

97.0

Smiles

TMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMH

Molecular Formula

2350 (Gene_ID) P14207 (T17-H228) (Accession)

Molecular Weight

Approximately 28-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trappc9 (NM_001034156) Rat Tagged ORF Clone
RR217499 10 µg

Trappc9 (NM_001034156) Rat Tagged ORF Clone

Sign In for Pricing
View Details
CRAT Peptide
MBS3236319-01 0.1 mg

CRAT Peptide

Sign In for Pricing
View Details
CRAT Peptide
MBS3236319-02 5x 0.1 mg

CRAT Peptide

Sign In for Pricing
View Details
Rabbit MAPK14 (Mitogen Activated Protein Kinase 14) ValidElisa Kit
EK346518 96 Well

Rabbit MAPK14 (Mitogen Activated Protein Kinase 14) ValidElisa Kit

Sign In for Pricing
View Details
Mouse Monoclonal MTF1 Antibody (OTI2F3) [Janelia Fluor 549]
NBP2-72796JF549 0.1 mL

Mouse Monoclonal MTF1 Antibody (OTI2F3) [Janelia Fluor 549]

Sign In for Pricing
View Details
C2CD4A (NM_207322) Human Tagged Lenti ORF Clone
RC221228L2 10 µg

C2CD4A (NM_207322) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details