Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].

Product Specifications

Product Name Alternative

Apolipoprotein H/APOH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-h-protein-human-hek293-his.html

Purity

97.00

Smiles

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Formula

350 (Gene_ID) P02749 (G20-C345) (Accession)

Molecular Weight

Approximately 45-70 kDa

References & Citations

[1]Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gpm6b sgRNA CRISPR Lentivector (Rat) (Target 3)
K6950804 1.0 µg DNA

Gpm6b sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
PGLYRP1 Protein Vector (Human) (pPB-C-His)
PV110702 500 ng

PGLYRP1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Vom2r58 (NM_001099479) Rat Tagged Lenti ORF Clone
RR214707L3 10 µg

Vom2r58 (NM_001099479) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human ST8SIA2 CF
6590-GT-020 20 µg

Recombinant Human ST8SIA2 CF

Sign In for Pricing
View Details
Lentiviral human ANKRA2 shRNA (UAS) - Lentiviral human ANKRA2 shRNA (UAS, RFP) (100)
GTR15343767 1 Vial

Lentiviral human ANKRA2 shRNA (UAS) - Lentiviral human ANKRA2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
CD90/Thy1, AbBy Fluor™ 555 Conjugated
bsm-60914R-BF555 100 µL

CD90/Thy1, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details