Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].

Product Specifications

Product Name Alternative

Apolipoprotein H/APOH Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-h-protein-human-hek293-his.html

Purity

97.00

Smiles

GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Formula

350 (Gene_ID) P02749 (G20-C345) (Accession)

Molecular Weight

Approximately 45-70 kDa

References & Citations

[1]Mather KA, et al. Genome-wide significant results identified for plasma apolipoprotein H levels in middle-agedand older adults. Sci Rep. 2016 Mar 31;6:23675.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal beta-Catenin Antibody (CTNNB1/2030R) [Janelia Fluor 646]
NBP2-79888JF646 0.1 mL

Rabbit Monoclonal beta-Catenin Antibody (CTNNB1/2030R) [Janelia Fluor 646]

Sign In for Pricing
View Details
E199 With Earle's salts and L-glutamine. No sodium bicarbonate.
MDP08-10LT 10 L

E199 With Earle's salts and L-glutamine. No sodium bicarbonate.

Sign In for Pricing
View Details
CD117 (c-kit, Stem Cell Factor, SCF Receptor, Steel Factor Receptor, Mast Cell Growth Factor, MGF) (MaxLight 550)
MBS6468210-01 0.1 mL

CD117 (c-kit, Stem Cell Factor, SCF Receptor, Steel Factor Receptor, Mast Cell Growth Factor, MGF) (MaxLight 550)

Sign In for Pricing
View Details
CD117 (c-kit, Stem Cell Factor, SCF Receptor, Steel Factor Receptor, Mast Cell Growth Factor, MGF) (MaxLight 550)
MBS6468210-02 5x 0.1 mL

CD117 (c-kit, Stem Cell Factor, SCF Receptor, Steel Factor Receptor, Mast Cell Growth Factor, MGF) (MaxLight 550)

Sign In for Pricing
View Details
Mouse Colony Stimulating Factor 3, Granulocyte (GCSF) CLIA Kit
MBS2001051-01 24 Strip Well

Mouse Colony Stimulating Factor 3, Granulocyte (GCSF) CLIA Kit

Sign In for Pricing
View Details
Mouse Colony Stimulating Factor 3, Granulocyte (GCSF) CLIA Kit
MBS2001051-02 48 Well

Mouse Colony Stimulating Factor 3, Granulocyte (GCSF) CLIA Kit

Sign In for Pricing
View Details