Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuregulin-4/NRG4, Human

Neuregulin-4 (NRG4) Protein, a low-affinity ligand for the ERBB4 tyrosine kinase receptor, serves as a signaling molecule that recruits ERBB1 and ERBB2 coreceptors. This recruitment leads to ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. NRG4 specifically interacts with the ERBB4 receptor, mediating cellular responses through its activation, without binding to ERBB1, ERBB2, and ERBB3 receptors. Neuregulin-4/NRG4 Protein, Human is the recombinant human-derived Neuregulin-4/NRG4 protein, expressed by E. coli, with tag free.

Product Specifications

Product Name Alternative

Neuregulin-4/NRG4 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/neuregulin-4-nrg4-protein-human.html

Purity

94.20

Smiles

GPPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF

Molecular Formula

145957 (Gene_ID) Q8WWG1 (N-G&P, P2-F62) (Accession)

Molecular Weight

Approximately 6.7-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100360148 3'UTR Luciferase Stable Cell Line
TU207459 1.0 mL

LOC100360148 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MCRS1 Recombinant Protein (Mouse)
RP149885 100 µg

MCRS1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
BC089597 (Rdh16f2) (NM_145424) Mouse Tagged Lenti ORF Clone
MR204597L3 10 µg

BC089597 (Rdh16f2) (NM_145424) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
N-Glycolylneuraminic Acid
G8175 10 mg

N-Glycolylneuraminic Acid

Sign In for Pricing
View Details
Rat SBP1 (Selenium-binding protein 1) ELISA Kit
MBS7607130-01 48 Well

Rat SBP1 (Selenium-binding protein 1) ELISA Kit

Sign In for Pricing
View Details
Rat SBP1 (Selenium-binding protein 1) ELISA Kit
MBS7607130-02 96 Well

Rat SBP1 (Selenium-binding protein 1) ELISA Kit

Sign In for Pricing
View Details