Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuregulin-4/NRG4, Human

Neuregulin-4 (NRG4) Protein, a low-affinity ligand for the ERBB4 tyrosine kinase receptor, serves as a signaling molecule that recruits ERBB1 and ERBB2 coreceptors. This recruitment leads to ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. NRG4 specifically interacts with the ERBB4 receptor, mediating cellular responses through its activation, without binding to ERBB1, ERBB2, and ERBB3 receptors. Neuregulin-4/NRG4 Protein, Human is the recombinant human-derived Neuregulin-4/NRG4 protein, expressed by E. coli, with tag free.

Product Specifications

Product Name Alternative

Neuregulin-4/NRG4 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/neuregulin-4-nrg4-protein-human.html

Purity

94.20

Smiles

GPPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF

Molecular Formula

145957 (Gene_ID) Q8WWG1 (N-G&P, P2-F62) (Accession)

Molecular Weight

Approximately 6.7-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prkrir sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
37657114 3x 1.0 µg

Prkrir sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse IgG2b (gamma 2b chain specific) Rabbit Polyclonal Antibody
R1361F 1 mg

Mouse IgG2b (gamma 2b chain specific) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Olfr1002 (NM_146573) Mouse Tagged Lenti ORF Clone
MR216964L3 10 µg

Olfr1002 (NM_146573) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TM9SF1 CRISPR Knock Out 293T Cell Line (Human)
46805141 1x 10^6 Cells / 1.0 mL

TM9SF1 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Pigeon Synaptotagmin-17 (SYT17) ELISA Kit
MBS9936242 Inquire

Pigeon Synaptotagmin-17 (SYT17) ELISA Kit

Sign In for Pricing
View Details
1, 3, 5 (10) -ESTRATRIEN-3, 16α, 17β-TRIOL 16, 17-DIACETATE
504857 Inquire

1, 3, 5 (10) -ESTRATRIEN-3, 16α, 17β-TRIOL 16, 17-DIACETATE

Sign In for Pricing
View Details