Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuregulin-4/NRG4, Human

Neuregulin-4 (NRG4) Protein, a low-affinity ligand for the ERBB4 tyrosine kinase receptor, serves as a signaling molecule that recruits ERBB1 and ERBB2 coreceptors. This recruitment leads to ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. NRG4 specifically interacts with the ERBB4 receptor, mediating cellular responses through its activation, without binding to ERBB1, ERBB2, and ERBB3 receptors. Neuregulin-4/NRG4 Protein, Human is the recombinant human-derived Neuregulin-4/NRG4 protein, expressed by E. coli, with tag free.

Product Specifications

Product Name Alternative

Neuregulin-4/NRG4 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/neuregulin-4-nrg4-protein-human.html

Purity

94.20

Smiles

GPPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF

Molecular Formula

145957 (Gene_ID) Q8WWG1 (N-G&P, P2-F62) (Accession)

Molecular Weight

Approximately 6.7-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ceacam15 Mouse qPCR Primer Pair (NM_175315)
MP222443 200 Reactions

Ceacam15 Mouse qPCR Primer Pair (NM_175315)

Sign In for Pricing
View Details
PRDM16/MEL1 Recombinant Protein Antigen
NBP2-56472PEP 100 µL

PRDM16/MEL1 Recombinant Protein Antigen

Sign In for Pricing
View Details
Recombinant Human Diacylglycerol kinase alpha Protein, His, E.coli-10ug
QP5930-ec-10ug 10ug

Recombinant Human Diacylglycerol kinase alpha Protein, His, E.coli-10ug

Sign In for Pricing
View Details
Lentiviral mouse Fam71f1 shRNA (UAS) - Lentiviral mouse Fam71f1 shRNA (UAS) (100)
GTR15159114 1 Vial

Lentiviral mouse Fam71f1 shRNA (UAS) - Lentiviral mouse Fam71f1 shRNA (UAS) (100)

Sign In for Pricing
View Details
PTTG1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
38197124 3x 1.0µg DNA

PTTG1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Sels Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV814060 1.0 µg DNA

Sels Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details