Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuregulin-4/NRG4, Human

Neuregulin-4 (NRG4) Protein, a low-affinity ligand for the ERBB4 tyrosine kinase receptor, serves as a signaling molecule that recruits ERBB1 and ERBB2 coreceptors. This recruitment leads to ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. NRG4 specifically interacts with the ERBB4 receptor, mediating cellular responses through its activation, without binding to ERBB1, ERBB2, and ERBB3 receptors. Neuregulin-4/NRG4 Protein, Human is the recombinant human-derived Neuregulin-4/NRG4 protein, expressed by E. coli, with tag free.

Product Specifications

Product Name Alternative

Neuregulin-4/NRG4 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/neuregulin-4-nrg4-protein-human.html

Purity

94.20

Smiles

GPPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLF

Molecular Formula

145957 (Gene_ID) Q8WWG1 (N-G&P, P2-F62) (Accession)

Molecular Weight

Approximately 6.7-14 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp503 Protein Lysate (Mouse) with C-HA Tag
50999034 100 µg

Zfp503 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Human GFPT1 Pre-designed siRNA Set A
SI006194A 1 Each

Human GFPT1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
BC046331 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4255102 1.0 µg DNA

BC046331 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Human Uncharacterized protein C20orf152, C20orf152 ELISA Kit
MBS9334884-01 48 Well

Human Uncharacterized protein C20orf152, C20orf152 ELISA Kit

Sign In for Pricing
View Details
Human Uncharacterized protein C20orf152, C20orf152 ELISA Kit
MBS9334884-02 96 Well

Human Uncharacterized protein C20orf152, C20orf152 ELISA Kit

Sign In for Pricing
View Details
Human Uncharacterized protein C20orf152, C20orf152 ELISA Kit
MBS9334884-03 5x 96 Well

Human Uncharacterized protein C20orf152, C20orf152 ELISA Kit

Sign In for Pricing
View Details