Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin A1, Rat (HEK293, His)

The serpin A1 protein is a vigilant guardian in cell regulation, effectively inhibiting elastase and providing a strong barrier to its enzymatic activity.Serpin A1 has moderate affinity for plasmin and thrombin and exhibits versatility in binding a range of serine proteases.Serpin A1 Protein, Rat (HEK293, His) is the recombinant rat-derived Serpin A1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Serpin A1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serpina1-protein-rat-hek293-his.html

Purity

98.0

Smiles

EDAQETDTSQQDQSPTYRKISSNLADFAFSLYRELVHQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPEADIHKAFHHLLQTLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVNFADSEEAKKVINDYVEKGTQGKIVDLMKQLDEDTVFALVNYIFFKGKWKRPFNPEHTRDADFHVDKSTTVKVPMMNRLGMFDMHYCSTLSSWVLMMDYLGNATAIFLLPDDGKMQHLEQTLTKDLISRFLLNRQTRSAILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLSGITEDAPLKLSQAVHKAVLTLDERGTEAAGATVVEAVPMSLPPQVKFDHPFIFMIVESETQSPLFVGKVIDPTR

Molecular Formula

24648 (Gene_ID) P17475 (E25-R411) (Accession)

Molecular Weight

Approximately 50-60 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibin β-B Double Nickase Plasmid (m2)
sc-421131-NIC-2 20 µg

Inhibin β-B Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
URAT1&XO inhibitor 2
HY-153972-01 5 mg

URAT1&XO inhibitor 2

Sign In for Pricing
View Details
URAT1&XO inhibitor 2
HY-153972-02 10 mM - 1 mL

URAT1&XO inhibitor 2

Sign In for Pricing
View Details
URAT1&XO inhibitor 2
HY-153972-03 10 mg

URAT1&XO inhibitor 2

Sign In for Pricing
View Details
URAT1&XO inhibitor 2
HY-153972-04 25 mg

URAT1&XO inhibitor 2

Sign In for Pricing
View Details
URAT1&XO inhibitor 2
HY-153972-05 50 mg

URAT1&XO inhibitor 2

Sign In for Pricing
View Details