Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTRH2, Human (His)

PTRH2, an enzyme with potential peptidyl-tRNA affinity, promotes caspase-independent apoptosis. It regulates transcriptional regulators AES and TLE1, contributing to the intricate machinery governing apoptotic processes. PTRH2 Protein, Human (His) is the recombinant human-derived PTRH2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

PTRH2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ptrh2-protein-human-his.html

Purity

95.00

Smiles

GEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY

Molecular Formula

51651 (Gene_ID) Q9Y3E5 (G63-Y179) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine cytochrome P450 2E1, CYP2E1 ELISA Kit
MBS166125-01 48 Well

Porcine cytochrome P450 2E1, CYP2E1 ELISA Kit

Sign In for Pricing
View Details
Porcine cytochrome P450 2E1, CYP2E1 ELISA Kit
MBS166125-02 96 Well

Porcine cytochrome P450 2E1, CYP2E1 ELISA Kit

Sign In for Pricing
View Details
Porcine cytochrome P450 2E1, CYP2E1 ELISA Kit
MBS166125-03 5x 96 Well

Porcine cytochrome P450 2E1, CYP2E1 ELISA Kit

Sign In for Pricing
View Details
Porcine cytochrome P450 2E1, CYP2E1 ELISA Kit
MBS166125-04 10x 96 Well

Porcine cytochrome P450 2E1, CYP2E1 ELISA Kit

Sign In for Pricing
View Details
anti-EPO Receptor
YF-PA23657 50 ul

anti-EPO Receptor

Sign In for Pricing
View Details
Recombinant Cercopithecine herpesvirus 1 Envelope glycoprotein D (gD)
orb2925498-01 20 µg

Recombinant Cercopithecine herpesvirus 1 Envelope glycoprotein D (gD)

Sign In for Pricing
View Details